GAPDHS (Rattus norvegicus)
Description [+]
- Synonyms: GAPDHS
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:RefSeq_peptide;Acc:NP_076454]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: GAPDHS-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Gp_dh_N | 100 | 248 |
PFAM A | Gp_dh_C | 253 | 410 |
Protein sequence [+]
Gapdhs | Rattus norvegicus | 10116 | length:432
MSRRDVILTNVTVVQLRRDPCPCPCPCPCPCPCPVIRPPPPPPKVEEPPPPKEEPPPPPP
PPPPPQIEPEEPKEAPPPPPPPPPPPPPPPPPPPKPAKELTVGINGFGRIGRLVLRVCME
KGVRVVAVNDPFIDPEYMVYMFKYDSTHGRYKGTVEHKNGRLVVDNLEINVFQCKEPKEI
PWSSVGNPYVVEATGVYLSIEAASGHISSGARRVIVTAPSPDAPMLVMGVNEKDYNPGSM
TVVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHAYTATQKTVDGPSKKDWRGGRGAHQ
NIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAQPASYTAIKEAVKA
AAKGPMAGILAYTEDQVVSTDFNGDSHSSIFDAKAGIALNDNFVKLVSWYDNEYGYSHRV
VDLLRYMFSREK
PPPPPQIEPEEPKEAPPPPPPPPPPPPPPPPPPPKPAKELTVGINGFGRIGRLVLRVCME
KGVRVVAVNDPFIDPEYMVYMFKYDSTHGRYKGTVEHKNGRLVVDNLEINVFQCKEPKEI
PWSSVGNPYVVEATGVYLSIEAASGHISSGARRVIVTAPSPDAPMLVMGVNEKDYNPGSM
TVVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHAYTATQKTVDGPSKKDWRGGRGAHQ
NIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAQPASYTAIKEAVKA
AAKGPMAGILAYTEDQVVSTDFNGDSHSSIFDAKAGIALNDNFVKLVSWYDNEYGYSHRV
VDLLRYMFSREK
Structure links:
- Prosite motif and domain information: PS00071
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0006096 | glycolysis | biological_proccess | IEA |
GO:0007286 | spermatid development | biological_proccess | IEP |
GO:0030317 | sperm motility | biological_proccess | IEA |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0007186 | G-protein coupled receptor protein signaling pathway | biological_proccess | IEA |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity | mollecular_function | IEA |
GO:0005488 | binding | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0051287 | NAD or NADH binding | mollecular_function | IEA |
GO:0005179 | hormone activity | mollecular_function | IEA |
GO:0005199 | structural constituent of cell wall | mollecular_function | IEA |
GO:0008943 | glyceraldehyde-3-phosphate dehydrogenase activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0001669 | acrosome | cell_component | TAS |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0009434 | microtubule-based flagellum | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0015629 | actin cytoskeleton | cell_component | IEA |
GO:0019861 | flagellum | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000021009
- Expression info from Arrayexpress [?] : ENSRNOG00000021009
- Protein expression from Protein Atlas: [?] ENSRNOG00000021009
Click on [?] for more information.