MAPK8 (Rattus norvegicus)
Description [+]
- Synonyms: MAPK8
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Mitogen-activated protein kinase 8 (EC 2.7.11.24) (Stress-activated protein kinase JNK1) (c-Jun N-terminal kinase 1) (SAPK gamma) (p54 gamma). [Source:UniProtKB/Swiss-Prot;Acc:P49185]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK8-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 26 | 317 |
PFAM A | Pkinase_Tyr | 26 | 252 |
Protein sequence [+]
Mapk8 | Rattus norvegicus | 10116 | length:423
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYMMQSYYASLILTILCFFFFLDLWSVGCIMGEMVALSYLIIDIDQWNKVIEQLGTP
CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVI
DASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLE
ERTKNGVIRGQPSPLGAAVINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASAGPLG
CCR
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYMMQSYYASLILTILCFFFFLDLWSVGCIMGEMVALSYLIIDIDQWNKVIEQLGTP
CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVI
DASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLE
ERTKNGVIRGQPSPLGAAVINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASAGPLG
CCR
Structure links:
- Smartdomain prediction information: SM00220
- Smartdomain prediction information: SM00219
- Prosite motif and domain information: PS00108
- Prosite motif and domain information: PS00152
- Prosite motif and domain information: PS01351
- Interpro domain information: P49185
- PFAM domain and domain family information: P49185
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0007258 | JUN phosphorylation | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0018107 | peptidyl-threonine phosphorylation | biological_proccess | IEA |
GO:0031558 | induction of apoptosis in response to chemical stimulus | biological_proccess | IEA |
GO:0046686 | response to cadmium ion | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IDA |
GO:0006954 | inflammatory response | biological_proccess | IDA |
GO:0006970 | response to osmotic stress | biological_proccess | IDA |
GO:0007165 | signal transduction | biological_proccess | IDA |
GO:0009408 | response to heat | biological_proccess | IDA |
GO:0030335 | positive regulation of cell migration | biological_proccess | IDA |
GO:0031116 | positive regulation of microtubule polymerization | biological_proccess | IMP |
GO:0031175 | neurite development | biological_proccess | IMP |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IDA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEP |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IDA |
GO:0045740 | positive regulation of DNA replication | biological_proccess | IMP |
GO:0048545 | response to steroid hormone stimulus | biological_proccess | IEP |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004705 | JUN kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004705 | JUN kinase activity | mollecular_function | ISS |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0031982 | vesicle | cell_component | IDA |
GO:0032839 | dendrite cytoplasm | cell_component | IDA |
GO:0033267 | axon part | cell_component | IDA |
GO:0043204 | perikaryon | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000020155
- Expression info from Arrayexpress [?] : ENSRNOG00000020155
- Protein expression from Protein Atlas: [?] ENSRNOG00000020155
- entrezgene: 116554
Click on [?] for more information.