CSK (Rattus norvegicus)
Description [+]
- Synonyms: CSK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tyrosine-protein kinase CSK (EC 2.7.10.2) (C-SRC kinase). [Source:UniProtKB/Swiss-Prot;Acc:P32577]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CSK-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | SH3_1 | 12 | 68 |
PFAM A | SH3_2 | 13 | 68 |
PFAM A | SH2 | 82 | 156 |
PFAM A | Pkinase | 195 | 440 |
PFAM A | Pkinase_Tyr | 195 | 440 |
Protein sequence [+]
Csk | Rattus norvegicus | 10116 | length:450
MSAIQASWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYDVMK
NCWHLDAATRPTFLQLREQLEHIRTHELHL
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCEGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYDVMK
NCWHLDAATRPTFLQLREQLEHIRTHELHL
Structure links:
- Smartdomain prediction information: SM00326
- Smartdomain prediction information: SM00252
- Smartdomain prediction information: SM00220
- Smartdomain prediction information: SM00219
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS00109
- Interpro domain information: P32577
- PFAM domain and domain family information: P32577
- Protein 3D structures from PDB: 1K9A
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004715 | non-membrane spanning protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0005911 | cell-cell junction | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000019374
- Expression info from Arrayexpress [?] : ENSRNOG00000019374
- Protein expression from Protein Atlas: [?] ENSRNOG00000019374
- entrezgene: 315707
- refseq_dna: NM_001030039
- refseq_peptide: NP_001025210
Click on [?] for more information.