FAS (Rattus norvegicus)
Description [+]
- Synonyms: FAS
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor receptor superfamily member 6 precursor (FASLG receptor) (Apoptosis-mediating surface antigen FAS) (Apo-1 antigen) (CD95 antigen). [Source:UniProtKB/Swiss-Prot;Acc:Q63199]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: FAS-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 71 | 113 |
PFAM A | Death | 210 | 293 |
Protein sequence [+]
Fas | Rattus norvegicus | 10116 | length:314
VLAGPELNVRMQGTDSISEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCT
TSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFY
CNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGLAILFVFIYKR
YRKRQPGDPESGIPSPVKTIFCFSDVNLNKYIWRTAEKMKICDAKKFARQHKIPESKIDE
IEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQAMVWEDHENS
ISNSRNENEGQSLE
TSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFY
CNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGLAILFVFIYKR
YRKRQPGDPESGIPSPVKTIFCFSDVNLNKYIWRTAEKMKICDAKKFARQHKIPESKIDE
IEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQAMVWEDHENS
ISNSRNENEGQSLE
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001666 | response to hypoxia | biological_proccess | IEP |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEP |
GO:0007568 | aging | biological_proccess | IEP |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEP |
GO:0009636 | response to toxin | biological_proccess | IEP |
GO:0010035 | response to inorganic substance | biological_proccess | IEP |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEP |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEP |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0042698 | ovulation cycle | biological_proccess | IEP |
GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEP |
GO:0043627 | response to estrogen stimulus | biological_proccess | IEP |
GO:0002377 | immunoglobulin production | biological_proccess | IEA |
GO:0003014 | renal system process | biological_proccess | IEA |
GO:0006924 | activation-induced cell death of T cells | biological_proccess | IEA |
GO:0006925 | inflammatory cell apoptosis | biological_proccess | IEA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IEA |
GO:0019724 | B cell mediated immunity | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0045060 | negative thymic T cell selection | biological_proccess | IEA |
GO:0045619 | regulation of lymphocyte differentiation | biological_proccess | IEA |
GO:0045637 | regulation of myeloid cell differentiation | biological_proccess | IEA |
GO:0048536 | spleen development | biological_proccess | IEA |
GO:0050869 | negative regulation of B cell activation | biological_proccess | IEA |
GO:0051260 | protein homooligomerization | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | TAS |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005901 | caveola | cell_component | IEP |
GO:0016020 | membrane | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IDA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0009986 | cell surface | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000019142
- Expression info from Arrayexpress [?] : ENSRNOG00000019142
- Protein expression from Protein Atlas: [?] ENSRNOG00000019142
Click on [?] for more information.