AK3 (Rattus norvegicus)
Description [+]
- Synonyms: AK3
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: GTP:AMP phosphotransferase mitochondrial (EC 2.7.4.10) (Adenylate kinase 3) (AK3) (Adenylate kinase 3 alpha-like 1). [Source:UniProtKB/Swiss-Prot;Acc:P29411]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: AK3-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 12 | 192 |
PFAM A | ADK_lid | 128 | 163 |
Protein sequence [+]
Ak3 | Rattus norvegicus | 10116 | length:227
MGASGRLLRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFI
DQGKLIPDDVMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEV
IKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQT
EPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQMKVPETIQKASVTP
DQGKLIPDDVMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEV
IKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQT
EPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQMKVPETIQKASVTP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0006756 | AMP phosphorylation | biological_proccess | IDA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0005525 | GTP binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IDA |
GO:0046899 | nucleoside triphosphate adenylate kinase activity | mollecular_function | IEA |
GO:0004765 | shikimate kinase activity | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | ISS |
GO:0005759 | mitochondrial matrix | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000015273
- Expression info from Arrayexpress [?] : ENSRNOG00000015273
- Protein expression from Protein Atlas: [?] ENSRNOG00000015273
Click on [?] for more information.