ANP32A (Rattus norvegicus)
Description [+]
- Synonyms: ANP32A
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Acidic leucine-rich nuclear phosphoprotein 32 family member A (Leucine-rich acidic nuclear protein). [Source:UniProtKB/Swiss-Prot;Acc:P49911]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANP32A-R_norvegicus
Structure & Sequence [+]
Protein sequence [+]
Anp32a | Rattus norvegicus | 10116 | length:247
LILTQKQVKRVTNCRPFKVKELVLDNCRSIEGKIEGLTDEFEELEFLSTINVGLTSISNL
PKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEY
AQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEDAAEEEGSQKRKREPD
DEGEEDD
PKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEY
AQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEDAAEEEGSQKRKREPD
DEGEEDD
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006350 | transcription | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006913 | nucleocytoplasmic transport | biological_proccess | ISS |
GO:0008022 | protein C-terminus binding | mollecular_function | IPI |
GO:0008092 | cytoskeletal protein binding | mollecular_function | TAS |
GO:0050839 | cell adhesion molecule binding | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | ISS |
GO:0005737 | cytoplasm | cell_component | ISS |
GO:0005783 | endoplasmic reticulum | cell_component | ISS |
GO:0048471 | perinuclear region of cytoplasm | cell_component | ISS |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000014846
- Expression info from Arrayexpress [?] : ENSRNOG00000014846
- Protein expression from Protein Atlas: [?] ENSRNOG00000014846
Click on [?] for more information.