CASP6 (Rattus norvegicus)
Description [+]
- Synonyms: CASP6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Caspase-6 precursor (EC 3.4.22.59) (CASP-6) (Apoptotic protease Mch-2) [Contains: Caspase-6 subunit p18; Caspase-6 subunit p11]. [Source:UniProtKB/Swiss-Prot;Acc:O35397]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP6-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 28 | 271 |
Protein sequence [+]
Casp6 | Rattus norvegicus | 10116 | length:277
MTETDGFYRSREVLDPAEQYKMDHKRRGTALIFNHERFFWHLALPERRGTNADRDNLTRR
FSELGFEVKCFNDLRAEELLLKIHEVSTSSHVDADCFLCVFLSHGEGNHIYAYDAKIEIQ
TLTGLFKGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDVVDHQTDKLDDNVTQVDAASV
YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARHGSSLEFTELLTLVNRKVS
QRRVDFCKDPGAIGKKQVPCFASMLTKKLHFCPKPSK
FSELGFEVKCFNDLRAEELLLKIHEVSTSSHVDADCFLCVFLSHGEGNHIYAYDAKIEIQ
TLTGLFKGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDVVDHQTDKLDDNVTQVDAASV
YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARHGSSLEFTELLTLVNRKVS
QRRVDFCKDPGAIGKKQVPCFASMLTKKLHFCPKPSK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002088 | lens development in camera-type eye | biological_proccess | IEP |
GO:0002525 | acute inflammatory response to non-antigenic stimulus | biological_proccess | IDA |
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0009408 | response to heat | biological_proccess | IEP |
GO:0009749 | response to glucose stimulus | biological_proccess | IMP |
GO:0010039 | response to iron ion | biological_proccess | IMP |
GO:0010243 | response to organic nitrogen | biological_proccess | IEP |
GO:0010332 | response to gamma radiation | biological_proccess | IEP |
GO:0032355 | response to estradiol stimulus | biological_proccess | IEP |
GO:0033574 | response to testosterone stimulus | biological_proccess | IEP |
GO:0034097 | response to cytokine stimulus | biological_proccess | IDA |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IDA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IMP |
GO:0046670 | positive regulation of retinal cell programmed cell death | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IDA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000009508
- Expression info from Arrayexpress [?] : ENSRNOG00000009508
- Protein expression from Protein Atlas: [?] ENSRNOG00000009508
Click on [?] for more information.