BCL2L10 (Rattus norvegicus)
Description [+]
- Synonyms: BCL2L10
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Bcl2-like 10 [Source:RefSeq_peptide;Acc:NP_446185]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCL2L10-R_norvegicus
Structure & Sequence [+]
Protein sequence [+]
Bcl2l10 | Rattus norvegicus | 10116 | length:185
MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDY
QGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDC
YLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFY
IWKCL
QGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDC
YLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFY
IWKCL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0031965 | nuclear membrane | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000009308
- Expression info from Arrayexpress [?] : ENSRNOG00000009308
- Protein expression from Protein Atlas: [?] ENSRNOG00000009308
Click on [?] for more information.