TNFSF15 (Rattus norvegicus)
Description [+]
- Synonyms: TNFSF15
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: tumor necrosis factor (ligand) superfamily, member 15 [Source:RefSeq_peptide;Acc:NP_665708]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF15-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 118 | 252 |
Protein sequence [+]
Tnfsf15 | Rattus norvegicus | 10116 | length:252
MAEELGLGFGEAVPVEMLPEGCRHRREARTGLAARSKACLALTCCLLSFPILAGLSTLLM
TGQLRIPGKDCMFPTVTEERSAPSAQPVYTPSRDKPKAHLTIMRQTPVPHLKNELAALHW
ENNLGMAFTKNRMNYTNKFLVIPESGDYFIYSQITFRGTTSECGDISRVRRPKKPDSITV
VITKVADSYPEPAHLLTGTKSVCEISSNWFQPIYLGAMFSLEEGDRLMVNVSDISLVDYT
KEDKTFFGAFLI
TGQLRIPGKDCMFPTVTEERSAPSAQPVYTPSRDKPKAHLTIMRQTPVPHLKNELAALHW
ENNLGMAFTKNRMNYTNKFLVIPESGDYFIYSQITFRGTTSECGDISRVRRPKKPDSITV
VITKVADSYPEPAHLLTGTKSVCEISSNWFQPIYLGAMFSLEEGDRLMVNVSDISLVDYT
KEDKTFFGAFLI
Structure links:
- Smartdomain prediction information: SM00207
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006919 | activation of caspase activity | biological_proccess | IDA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IDA |
GO:0001937 | negative regulation of endothelial cell proliferation | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IEA |
GO:0042107 | cytokine metabolic process | biological_proccess | IEA |
GO:0005123 | death receptor binding | mollecular_function | IDA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000008930
- Expression info from Arrayexpress [?] : ENSRNOG00000008930
- Protein expression from Protein Atlas: [?] ENSRNOG00000008930
Click on [?] for more information.