SH3GL2 (Rattus norvegicus)
Description [+]
- Synonyms: SH3GL2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Endophilin-A1 (Endophilin-1) (SH3 domain-containing GRB2-like protein 2) (SH3 domain protein 2A) (SH3p4). [Source:UniProtKB/Swiss-Prot;Acc:O35179]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: SH3GL2-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | BAR | 1 | 138 |
| PFAM A | SH3_1 | 189 | 243 |
| PFAM A | SH3_2 | 190 | 243 |
Protein sequence [+]
Sh3gl2 | Rattus norvegicus | 10116 | length:248
GDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGR
RLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLE
YHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDGTQPNGGLSHTGTPK
PAGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYV
EILVALPH
RLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLE
YHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDGTQPNGGLSHTGTPK
PAGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYV
EILVALPH
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006897 | endocytosis | biological_proccess | IEA |
| GO:0048489 | synaptic vesicle transport | biological_proccess | IPI |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0008289 | lipid binding | mollecular_function | IEA |
| GO:0042802 | identical protein binding | mollecular_function | IEA |
| GO:0005737 | cytoplasm | cell_component | IEA |
| GO:0005886 | plasma membrane | cell_component | EXP |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000006761
- Expression info from Arrayexpress [?] : ENSRNOG00000006761
- Protein expression from Protein Atlas: [?] ENSRNOG00000006761
- entrezgene: 116743
Click on [?] for more information.
