CALR_RAT (Rattus norvegicus)
Description [+]
- Synonyms: CALR_RAT
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Calreticulin Precursor (CRP55)(Calregulin)(HACBP)(ERp60)(CALBP)(Calcium-binding protein 3)(CABP3) [Source:UniProtKB/Swiss-Prot;Acc:P18418]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CALR_RAT-R_norvegicus
Structure & Sequence [+]
Protein sequence [+]
CALR_RAT | Rattus norvegicus | 10116 | length:416
MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002502 | peptide antigen assembly with MHC class I protein complex | biological_proccess | IEA |
GO:0006457 | protein folding | biological_proccess | IEA |
GO:0017148 | negative regulation of translation | biological_proccess | IDA |
GO:0030866 | cortical actin cytoskeleton organization | biological_proccess | IEA |
GO:0040020 | regulation of meiosis | biological_proccess | IEA |
GO:0050766 | positive regulation of phagocytosis | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0007050 | cell cycle arrest | biological_proccess | IEA |
GO:0006611 | protein export from nucleus | biological_proccess | IEA |
GO:0045740 | positive regulation of DNA replication | biological_proccess | IEA |
GO:0033144 | negative regulation of steroid hormone receptor signaling pathway | biological_proccess | IEA |
GO:0045665 | negative regulation of neuron differentiation | biological_proccess | IEA |
GO:0048387 | negative regulation of retinoic acid receptor signaling pathway | biological_proccess | IEA |
GO:0010149 | senescence | biological_proccess | IEA |
GO:0045787 | positive regulation of cell cycle | biological_proccess | IEA |
GO:0003729 | mRNA binding | mollecular_function | IDA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005529 | sugar binding | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0051082 | unfolded protein binding | mollecular_function | IEA |
GO:0016564 | transcription repressor activity | mollecular_function | IEA |
GO:0005178 | integrin binding | mollecular_function | IEA |
GO:0050681 | androgen receptor binding | mollecular_function | IEA |
GO:0003729 | mRNA binding | mollecular_function | IEA |
GO:0008937 | ferredoxin reductase activity | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | TAS |
GO:0005783 | endoplasmic reticulum | cell_component | IDA |
GO:0005788 | endoplasmic reticulum lumen | cell_component | IEA |
GO:0005792 | microsome | cell_component | IEA |
GO:0005844 | polysome | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0042824 | MHC class I peptide loading complex | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000003029
- Expression info from Arrayexpress [?] : ENSRNOG00000003029
- Protein expression from Protein Atlas: [?] ENSRNOG00000003029
Click on [?] for more information.