FASLG (Rattus norvegicus)
Description [+]
- Synonyms: FASLG
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor ligand superfamily member 6 (Fas antigen ligand) (Fas ligand) (CD178 antigen) (CD95L protein) [Contains: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble for [Source:UniProtKB/Swiss-Prot;Acc:P36940]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: FASLG-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 157 | 278 |
Protein sequence [+]
Faslg | Rattus norvegicus | 10116 | length:278
MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQ
PPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLR
VSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVI
NEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSS
YLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL
PPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLR
VSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVI
NEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSS
YLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006925 | inflammatory cell apoptosis | biological_proccess | IGI |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IMP |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEP |
GO:0007186 | G-protein coupled receptor protein signaling pathway | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0046666 | retinal cell programmed cell death | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0070265 | necrotic cell death | biological_proccess | IEA |
GO:0005123 | death receptor binding | mollecular_function | IC |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005179 | hormone activity | mollecular_function | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0005901 | caveola | cell_component | IDA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0016023 | cytoplasmic membrane-bounded vesicle | cell_component | IDA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
GO:0015629 | actin cytoskeleton | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000002978
- Expression info from Arrayexpress [?] : ENSRNOG00000002978
- Protein expression from Protein Atlas: [?] ENSRNOG00000002978
Click on [?] for more information.