TNF (Rattus norvegicus)
Description [+]
- Synonyms: TNF
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor precursor (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) (Cachectin) [Contains: Tumor necrosis factor, membrane form; Tumor necrosis factor, soluble form]. [Source:UniProtKB/Swiss-Prot;Acc:P16599]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNF-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 105 | 235 |
Protein sequence [+]
Tnf | Rattus norvegicus | 10116 | length:235
MSTESMIRDVELAEEALPKKMGGLQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPNK
EEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCP
KDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
EEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCP
KDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0001775 | cell activation | biological_proccess | IDA |
GO:0001932 | regulation of protein amino acid phosphorylation | biological_proccess | IEA |
GO:0002037 | negative regulation of L-glutamate transport | biological_proccess | IDA |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IDA |
GO:0006954 | inflammatory response | biological_proccess | TAS |
GO:0006959 | humoral immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IDA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IDA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0009612 | response to mechanical stimulus | biological_proccess | IEP |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0019722 | calcium-mediated signaling | biological_proccess | IDA |
GO:0042742 | defense response to bacterium | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IMP |
GO:0045123 | cellular extravasation | biological_proccess | IEA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0045840 | positive regulation of mitosis | biological_proccess | IMP |
GO:0045941 | positive regulation of transcription | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0045994 | positive regulation of translational initiation by iron | biological_proccess | IEA |
GO:0046325 | negative regulation of glucose import | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0050806 | positive regulation of synaptic transmission | biological_proccess | IMP |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0051222 | positive regulation of protein transport | biological_proccess | IDA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0002740 | negative regulation of cytokine secretion during immune response | biological_proccess | IEA |
GO:0000187 | activation of MAPK activity | biological_proccess | IEA |
GO:0043193 | positive regulation of gene-specific transcription | biological_proccess | IEA |
GO:0001934 | positive regulation of protein amino acid phosphorylation | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0016481 | negative regulation of transcription | biological_proccess | IEA |
GO:0050901 | leukocyte tethering or rolling | biological_proccess | IEA |
GO:0051044 | positive regulation of membrane protein ectodomain proteolysis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IEA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
GO:0048661 | positive regulation of smooth muscle cell proliferation | biological_proccess | IEA |
GO:0032715 | negative regulation of interleukin-6 production | biological_proccess | IEA |
GO:0050995 | negative regulation of lipid catabolic process | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0030730 | sequestering of triglyceride | biological_proccess | IEA |
GO:0032722 | positive regulation of chemokine production | biological_proccess | IEA |
GO:0045071 | negative regulation of viral genome replication | biological_proccess | IEA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0042346 | positive regulation of NF-kappaB import into nucleus | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
GO:0002439 | chronic inflammatory response to antigenic stimulus | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0032800 | receptor biosynthetic process | biological_proccess | IEA |
GO:0050796 | regulation of insulin secretion | biological_proccess | IEA |
GO:0034116 | positive regulation of heterotypic cell-cell adhesion | biological_proccess | IEA |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | biological_proccess | IEA |
GO:0060559 | biological_proccess | IEA | |
GO:0060557 | biological_proccess | IEA | |
GO:0060555 | biological_proccess | IEA | |
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0006952 | defense response | biological_proccess | IEA |
GO:0007254 | JNK cascade | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0032755 | positive regulation of interleukin-6 production | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0050900 | leukocyte migration | biological_proccess | IEA |
GO:0030316 | osteoclast differentiation | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0001891 | phagocytic cup | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0055037 | recycling endosome | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000000837
- Expression info from Arrayexpress [?] : ENSRNOG00000000837
- Protein expression from Protein Atlas: [?] ENSRNOG00000000837
Click on [?] for more information.