PYDC1 (Pan troglodytes)
Description [+]
- Synonyms: PYDC1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Pyrin domain-containing protein 1 (Pyrin-only protein 1)(PAAD-only protein 1) [Source:UniProtKB/Swiss-Prot;Acc:Q8WXC3]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PYDC1-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | PAAD_DAPIN | 4 | 87 |
Protein sequence [+]
PYDC1 | Pan troglodytes | 9598 | length:89
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASY
YEDYAAELVVAVLRDMRMLEEAARLQRAA
YEDYAAELVVAVLRDMRMLEEAARLQRAA
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0032088 | negative regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0006469 | negative regulation of protein kinase activity | biological_proccess | IEA |
GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | IEA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0008385 | IkappaB kinase complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000008041
- Expression info from Arrayexpress [?] : ENSPTRG00000008041
- Protein expression from Protein Atlas: [?] ENSPTRG00000008041
- entrezgene: 742490
Click on [?] for more information.