PRDX3 (Pan troglodytes)
Description [+]
- Synonyms: PRDX3
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Thioredoxin-dependent peroxide reductase, mitochondrial Precursor (EC 1.11.1.15)(Peroxiredoxin-3)(PRX III)(Antioxidant protein 1)(AOP-1)(Protein MER5 homolog)(HBC189) [Source:UniProtKB/Swiss-Prot;Acc:P30048]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX3-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 64 | 219 |
PFAM A | AhpC-TSA | 65 | 198 |
PFAM A | 1-cysPrx_C | 208 | 251 |
Protein sequence [+]
PRDX3 | Pan troglodytes | 9598 | length:256
MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSC
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
KPSPAASKEYFQKVNQ
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
KPSPAASKEYFQKVNQ
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0030099 | myeloid cell differentiation | biological_proccess | IEA |
GO:0001893 | maternal placenta development | biological_proccess | IEA |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0007005 | mitochondrion organization | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0034614 | cellular response to reactive oxygen species | biological_proccess | IEA |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IEA |
GO:0033673 | negative regulation of kinase activity | biological_proccess | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0019901 | protein kinase binding | mollecular_function | IEA |
GO:0008022 | protein C-terminus binding | mollecular_function | IEA |
GO:0043027 | caspase inhibitor activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005769 | early endosome | cell_component | IEA |
GO:0008385 | IkappaB kinase complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000002992
- Expression info from Arrayexpress [?] : ENSPTRG00000002992
- Protein expression from Protein Atlas: [?] ENSPTRG00000002992
Click on [?] for more information.