XR_022030.1 (Pan troglodytes)
Description [+]
- Synonyms: XR_022030.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: PREDICTED: Pan troglodytes similar to KIAA0106 (LOC745434), mRNA. [Source:RefSeq_dna;Acc:XR_022030]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: XR_022030.1-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | AhpC-TSA | 7 | 146 |
PFAM A | 1-cysPrx_C | 156 | 218 |
Protein sequence [+]
XR_022030.1 | Pan troglodytes | 9598 | length:224
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0009395 | phospholipid catabolic process | biological_proccess | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0004623 | phospholipase A2 activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000001693
- Expression info from Arrayexpress [?] : ENSPTRG00000001693
- Protein expression from Protein Atlas: [?] ENSPTRG00000001693
Click on [?] for more information.