Q6UIS0_PANTR (Pan troglodytes)
Description [+]
- Synonyms: Q6UIS0_PANTR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Adenylate kinase 3 (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q6UIS0]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: Q6UIS0_PANTR-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 10 | 190 |
PFAM A | ADK_lid | 126 | 161 |
Protein sequence [+]
Q6UIS0_PANTR | Pan troglodytes | 9598 | length:223
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEK
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALNKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALNKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0004765 | shikimate kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0017111 | nucleoside-triphosphatase activity | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000000827
- Expression info from Arrayexpress [?] : ENSPTRG00000000827
- Protein expression from Protein Atlas: [?] ENSPTRG00000000827
Click on [?] for more information.