ANXA1_PONPY (Pongo pygmaeus)
Description [+]
- Synonyms: ANXA1_PONPY
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: Annexin A1 (Annexin-1). [Source:UniProtKB/Swiss-Prot;Acc:Q5REL2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANXA1_PONPY-P_pygmaeus
Structure & Sequence [+]
Protein sequence [+]
ANXA1_PONPY | Pongo pygmaeus | 9600 | length:346
MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGV
DEATIIDVLTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDA
DELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNAL
LSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKY
TKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIM
VSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN
DEATIIDVLTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDA
DELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNAL
LSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKY
TKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIM
VSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0050819 | negative regulation of coagulation | biological_proccess | IEA |
GO:0007010 | cytoskeleton organization | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0050482 | arachidonic acid secretion | biological_proccess | IEA |
GO:0018149 | peptide cross-linking | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0019834 | phospholipase A2 inhibitor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0030674 | protein binding, bridging | mollecular_function | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005929 | cilium | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016323 | basolateral plasma membrane | cell_component | IEA |
GO:0042995 | cell projection | cell_component | IEA |
GO:0042383 | sarcolemma | cell_component | IEA |
GO:0001533 | cornified envelope | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000019293
- Expression info from Arrayexpress [?] : ENSPPYG00000019293
- Protein expression from Protein Atlas: [?] ENSPPYG00000019293
Click on [?] for more information.