FAS (Pongo pygmaeus)
Description [+]
- Synonyms: FAS
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: Tumor necrosis factor receptor superfamily member 6 Precursor (FASLG receptor)(Apoptosis-mediating surface antigen FAS)(Apo-1 antigen)(CD95 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P25445]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: FAS-P_pygmaeus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 85 | 127 |
PFAM A | TNFR_c6 | 129 | 165 |
PFAM A | Death | 232 | 315 |
Protein sequence [+]
FAS | Pongo pygmaeus | 9600 | length:336
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCI
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIVKECTLTSNTKCKEEGSRSNLWWLCLL
LLFPILLIVWVKRKEVQKACRKHRKENQGPQESPTLNPETVAINLSDVDLSKYITTVAGV
MTLSQVKSFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKDAYDALIKGLK
KANLCTLAEKIQTIILKDITSDSENSNFRNETQSLV
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCI
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIVKECTLTSNTKCKEEGSRSNLWWLCLL
LLFPILLIVWVKRKEVQKACRKHRKENQGPQESPTLNPETVAINLSDVDLSKYITTVAGV
MTLSQVKSFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKDAYDALIKGLK
KANLCTLAEKIQTIILKDITSDSENSNFRNETQSLV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0048536 | spleen development | biological_proccess | IEA |
GO:0045619 | regulation of lymphocyte differentiation | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0051260 | protein homooligomerization | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0006924 | activation-induced cell death of T cells | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0006925 | inflammatory cell apoptosis | biological_proccess | IEA |
GO:0045060 | negative thymic T cell selection | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IEA |
GO:0002377 | immunoglobulin production | biological_proccess | IEA |
GO:0003014 | renal system process | biological_proccess | IEA |
GO:0019724 | B cell mediated immunity | biological_proccess | IEA |
GO:0045637 | regulation of myeloid cell differentiation | biological_proccess | IEA |
GO:0050869 | negative regulation of B cell activation | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0009986 | cell surface | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000002460
- Expression info from Arrayexpress [?] : ENSPPYG00000002460
- Protein expression from Protein Atlas: [?] ENSPPYG00000002460
Click on [?] for more information.