KAD4_PONPY (Pongo pygmaeus)
Description [+]
- Synonyms: KAD4_PONPY
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: Adenylate kinase isoenzyme 4, mitochondrial (EC 2.7.4.3) (Adenylate kinase 3-like 1) (ATP-AMP transphosphorylase). [Source:UniProtKB/Swiss-Prot;Acc:Q5R421]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: KAD4_PONPY-P_pygmaeus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 10 | 190 |
PFAM A | ADK_lid | 126 | 161 |
Protein sequence [+]
KAD4_PONPY | Pongo pygmaeus | 9600 | length:223
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKANTEVGEMAKQYIEK
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0005525 | GTP binding | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0004765 | shikimate kinase activity | mollecular_function | IEA |
GO:0017111 | nucleoside-triphosphatase activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005759 | mitochondrial matrix | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000001269
- Expression info from Arrayexpress [?] : ENSPPYG00000001269
- Protein expression from Protein Atlas: [?] ENSPPYG00000001269
Click on [?] for more information.