CD40 (Oryctolagus cuniculus)
Description [+]
- Synonyms: CD40
- Species: Oryctolagus cuniculus
- Short gene description: Tumor necrosis factor receptor superfamily member 5 Precursor (CD40L receptor)(B-cell surface antigen CD40)(Bp50)(CDw40)(CD40 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P25942]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40-O_cuniculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 26 | 59 |
Protein sequence [+]
CD40 | Oryctolagus cuniculus | 9986 | length:276
MLRLPVRCVLWGCLLTAVLPEPPTACRENQYQVNNQCCNLCPPGERLENECVDGTNTKCL
PCSNGEFLDTWNRETRCHQHKYCDPNLGLQVQREGTSETDTTCTCQEGQHCISDACDSCA
PHSSCPVGFGVRQKATEVSDTICEPCPDGFFSNVSSAVESCHPWTSCATHNLVELQAGTN
KTDVRCGAQDRKRALVLIPMVLGGVSAALLVSVYIRKAIKKPIDGYRVRTVGQDPVEMED
FPGHNTGAPVQETLHGCQPVTQEDGKESRIAVQERQ
PCSNGEFLDTWNRETRCHQHKYCDPNLGLQVQREGTSETDTTCTCQEGQHCISDACDSCA
PHSSCPVGFGVRQKATEVSDTICEPCPDGFFSNVSSAVESCHPWTSCATHNLVELQAGTN
KTDVRCGAQDRKRALVLIPMVLGGVSAALLVSVYIRKAIKKPIDGYRVRTVGQDPVEMED
FPGHNTGAPVQETLHGCQPVTQEDGKESRIAVQERQ
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IEA |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IEA |
GO:0050776 | regulation of immune response | biological_proccess | IEA |
GO:0048304 | positive regulation of isotype switching to IgG isotypes | biological_proccess | IEA |
GO:0042113 | B cell activation | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0002768 | immune response-regulating cell surface receptor signaling pathway | biological_proccess | IEA |
GO:0019899 | enzyme binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0043231 | intracellular membrane-bounded organelle | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOCUG00000005631
- Expression info from Arrayexpress [?] : ENSOCUG00000005631
- Protein expression from Protein Atlas: [?] ENSOCUG00000005631
Click on [?] for more information.