CYC_RABIT (Oryctolagus cuniculus)
Description [+]
- Synonyms: CYC_RABIT
- Species: Oryctolagus cuniculus
- Short gene description: Cytochrome c. [Source:UniProtKB/Swiss-Prot;Acc:P00008]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CYC_RABIT-O_cuniculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Cytochrom_C | 4 | 103 |
Protein sequence [+]
CYC_RABIT | Oryctolagus cuniculus | 9986 | length:105
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | ISS |
GO:0006810 | transport | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | ISS |
GO:0045333 | cellular respiration | biological_proccess | ISS |
GO:0005506 | iron ion binding | mollecular_function | IEA |
GO:0009055 | electron carrier activity | mollecular_function | IEA |
GO:0020037 | heme binding | mollecular_function | IEA |
GO:0045155 | electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity | mollecular_function | ISS |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005746 | mitochondrial respiratory chain | cell_component | IEA |
GO:0005758 | mitochondrial intermembrane space | cell_component | ISS |
GO:0005829 | cytosol | cell_component | ISS |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOCUG00000004875
- Expression info from Arrayexpress [?] : ENSOCUG00000004875
- Protein expression from Protein Atlas: [?] ENSOCUG00000004875
Click on [?] for more information.