TNFRSF1A (Ornithorhynchus anatinus)
Description [+]
- Synonyms: TNFRSF1A
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Prototheria; Ornithorhynchus anatinus
- Short gene description: Tumor necrosis factor receptor superfamily member 1A Precursor (p60)(TNF-R1)(TNF-RI)(TNFR-I)(p55)(CD120a antigen) [Contains Tumor necrosis factor receptor superfamily member 1A, membrane form;Tumor necrosis factor-binding protein 1(TBPI)] [Source:UniProtKB/Swiss-Prot;Acc:P19438]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF1A-O_anatinus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 87 | 128 |
PFAM A | TNFR_c6 | 130 | 168 |
Protein sequence [+]
TNFRSF1A | Ornithorhynchus anatinus | 9258 | length:400
LSLELMPCFGLPGTPLLFIPIPQPLGGVSSPPDTCQRSALKTHCPLSLPASSPSTTRSCL
CHDSPLAGTYLVAKCPEPGRESNCQVCAQGTYTAIENFSNNCLSCQRCRKELGQVEKLPC
TPDRNTECGCQENQYRLGRDHTFRCRNCSLCLNGSILHQCVENRDAVCLCNPGFFLKENK
CYPCHHCEDDPDCKKFCPNSSSPIQGLEPDNSAVLMPLVIFLSLCCFFLVLVGLAWHFQP
LKSKLTYLAGEEGVPQPLISSEENAANPQRGERGPFPAPGIPPSEHYPGPPSLSPASAPA
LVPSDWPPERVGRPPWSIEEVPPHPPASAATLTPALVQALPNCLNVLRPDNPAVLYAVVD
GVPPRWKEFMRRLGTEYEIERLELQNGALREAHYSMLTTW
CHDSPLAGTYLVAKCPEPGRESNCQVCAQGTYTAIENFSNNCLSCQRCRKELGQVEKLPC
TPDRNTECGCQENQYRLGRDHTFRCRNCSLCLNGSILHQCVENRDAVCLCNPGFFLKENK
CYPCHHCEDDPDCKKFCPNSSSPIQGLEPDNSAVLMPLVIFLSLCCFFLVLVGLAWHFQP
LKSKLTYLAGEEGVPQPLISSEENAANPQRGERGPFPAPGIPPSEHYPGPPSLSPASAPA
LVPSDWPPERVGRPPWSIEEVPPHPPASAATLTPALVQALPNCLNVLRPDNPAVLYAVVD
GVPPRWKEFMRRLGTEYEIERLELQNGALREAHYSMLTTW
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006952 | defense response | biological_proccess | IEA |
GO:0019221 | cytokine-mediated signaling pathway | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0050729 | positive regulation of inflammatory response | biological_proccess | IEA |
GO:0009816 | defense response to bacterium, incompatible interaction | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOANG00000010631
- Expression info from Arrayexpress [?] : ENSOANG00000010631
- Protein expression from Protein Atlas: [?] ENSOANG00000010631
Click on [?] for more information.