ANXA7 (Ornithorhynchus anatinus)
Description [+]
- Synonyms: ANXA7
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Prototheria; Ornithorhynchus anatinus
- Short gene description: Annexin A7 (Annexin-7)(Annexin VII)(Synexin) [Source:UniProtKB/Swiss-Prot;Acc:P20073]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANXA7-O_anatinus
Structure & Sequence [+]
Protein sequence [+]
ANXA7 | Ornithorhynchus anatinus | 9258 | length:315
ATQGTIRPAANFDALKDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTMYGK
DLIKDLKSELSGNMEELILALFMPPTYYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIQ
EIIRCYQSEFGRDIEKDIRSDTSGHFERLLISMCQGNRDENQTVNLQMAQEDAQRLYQAG
EGKLGTDESSFNMVLATRSFPQLKATMEAYSRMANRDLLSSIGREFSGNVENGLKTILQC
ALNRPAFFAERLYQSMKGAGTDDSSLVRIVVTRSEIDLVQVKQMFTQMYQKTLSTMISSD
TSGDYRRLLLAIVGQ
DLIKDLKSELSGNMEELILALFMPPTYYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIQ
EIIRCYQSEFGRDIEKDIRSDTSGHFERLLISMCQGNRDENQTVNLQMAQEDAQRLYQAG
EGKLGTDESSFNMVLATRSFPQLKATMEAYSRMANRDLLSSIGREFSGNVENGLKTILQC
ALNRPAFFAERLYQSMKGAGTDDSSLVRIVVTRSEIDLVQVKQMFTQMYQKTLSTMISSD
TSGDYRRLLLAIVGQ
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0006874 | cellular calcium ion homeostasis | biological_proccess | IEA |
GO:0008360 | regulation of cell shape | biological_proccess | IEA |
GO:0007599 | hemostasis | biological_proccess | IEA |
GO:0009651 | response to salt stress | biological_proccess | IEA |
GO:0009992 | cellular water homeostasis | biological_proccess | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0048306 | calcium-dependent protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0031982 | vesicle | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | IEA |
GO:0005626 | insoluble fraction | cell_component | IEA |
GO:0005635 | nuclear envelope | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOANG00000000320
- Expression info from Arrayexpress [?] : ENSOANG00000000320
- Protein expression from Protein Atlas: [?] ENSOANG00000000320
Click on [?] for more information.