TRP63 (Mus musculus)
Description [+]
- Synonyms: TRP63
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: transformation related protein 63 Gene [Source:MGI (curated);Acc:Trp63-003]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRP63-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53 | 163 | 359 |
PFAM A | P53_tetramer | 391 | 432 |
PFAM A | SAM_2 | 541 | 607 |
Protein sequence [+]
Trp63 | Mus musculus | 10090 | length:680
MNFETSRCATLQYCPDPYIQRFIETPAHFSWKESYYRSAMSQSTQTSEFLSPEVFQHIWD
FLEQPICSVQPIELNFVDEPSENGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSAKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSMQSQSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTMPEGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHDFSSPPHLLRTPSGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDSRRNKQQRIKEEGE
FLEQPICSVQPIELNFVDEPSENGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSAKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSMQSQSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTMPEGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHDFSSPPHLLRTPSGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDSRRNKQQRIKEEGE
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IGI |
GO:0001501 | skeletal system development | biological_proccess | IMP |
GO:0001736 | establishment of planar polarity | biological_proccess | IDA |
GO:0002053 | positive regulation of mesenchymal cell proliferation | biological_proccess | IMP |
GO:0002064 | epithelial cell development | biological_proccess | IDA |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IMP |
GO:0006917 | induction of apoptosis | biological_proccess | IDA |
GO:0007389 | pattern specification process | biological_proccess | IMP |
GO:0007499 | ectoderm and mesoderm interaction | biological_proccess | IMP |
GO:0007569 | cell aging | biological_proccess | IMP |
GO:0009887 | organ morphogenesis | biological_proccess | IMP |
GO:0009954 | proximal/distal pattern formation | biological_proccess | IMP |
GO:0010259 | multicellular organismal aging | biological_proccess | IMP |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0030326 | embryonic limb morphogenesis | biological_proccess | IMP |
GO:0030850 | prostate gland development | biological_proccess | IMP |
GO:0030859 | polarized epithelial cell differentiation | biological_proccess | IMP |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IMP |
GO:0035121 | tail morphogenesis | biological_proccess | IMP |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IMP |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IMP |
GO:0043589 | skin morphogenesis | biological_proccess | IMP |
GO:0043616 | keratinocyte proliferation | biological_proccess | IDA |
GO:0045617 | negative regulation of keratinocyte differentiation | biological_proccess | IGI |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IMP |
GO:0048485 | sympathetic nervous system development | biological_proccess | IMP |
GO:0048646 | anatomical structure formation involved in morphogenesis | biological_proccess | IMP |
GO:0048745 | smooth muscle development | biological_proccess | IMP |
GO:0048807 | female genitalia morphogenesis | biological_proccess | IMP |
GO:0051402 | neuron apoptosis | biological_proccess | IMP |
GO:0060157 | urinary bladder development | biological_proccess | IMP |
GO:0060197 | cloacal septation | biological_proccess | IMP |
GO:0007219 | Notch signaling pathway | biological_proccess | IEA |
GO:0008544 | epidermis development | biological_proccess | IMP |
GO:0030855 | epithelial cell differentiation | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | TAS |
GO:0001738 | morphogenesis of a polarized epithelium | biological_proccess | IMP |
GO:0001942 | hair follicle development | biological_proccess | IMP |
GO:0006350 | transcription | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | TAS |
GO:0030154 | cell differentiation | biological_proccess | IMP |
GO:0030216 | keratinocyte differentiation | biological_proccess | IDA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0045892 | negative regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045747 | positive regulation of Notch signaling pathway | biological_proccess | IEA |
GO:0051289 | protein homotetramerization | biological_proccess | IEA |
GO:0001302 | replicative cell aging | biological_proccess | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0003682 | chromatin binding | mollecular_function | IDA |
GO:0003684 | damaged DNA binding | mollecular_function | IDA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0043565 | sequence-specific DNA binding | mollecular_function | IDA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IDA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0016563 | transcription activator activity | mollecular_function | IEA |
GO:0016564 | transcription repressor activity | mollecular_function | IEA |
GO:0003690 | double-stranded DNA binding | mollecular_function | IEA |
GO:0019904 | protein domain specific binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | ISO |
GO:0043234 | protein complex | cell_component | IEA |
GO:0030425 | dendrite | cell_component | IEA |
GO:0019718 | rough microsome | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1330810
- Ensembl genome browser [?] : ENSMUSG00000022510
- Expression info from Arrayexpress [?] : ENSMUSG00000022510
- Protein expression from Protein Atlas: [?] ENSMUSG00000022510
- Community gene edition from Wikigenes: [?] 22061
- entrezgene: 22061
- refseq_dna: NM_001127265
- refseq_dna: NM_001127263
- refseq_dna: NM_001127264
- refseq_dna: NM_011641
- refseq_dna: NM_001127262
- refseq_dna: NM_001127261
- refseq_dna: NM_001127260
- refseq_dna: NM_001127259
- refseq_peptide: NP_001120735
- refseq_peptide: NP_001120737
- refseq_peptide: NP_001120736
- refseq_peptide: NP_001120734
- refseq_peptide: NP_035771
- refseq_peptide: NP_001120733
- refseq_peptide: NP_001120732
- refseq_peptide: NP_001120731
Click on [?] for more information.