PRDX2 (Mus musculus)
Description [+]
- Synonyms: PRDX2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: peroxiredoxin 2 Gene [Source:MGI (curated);Acc:Prdx2-003]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX2-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 7 | 162 |
PFAM A | AhpC-TSA | 8 | 141 |
PFAM A | 1-cysPrx_C | 151 | 194 |
Protein sequence [+]
Prdx2 | Mus musculus | 10090 | length:198
MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSD
HAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKN
DEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
HAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKN
DEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000187 | activation of MAPK activity | biological_proccess | IMP |
GO:0002536 | respiratory burst during acute inflammatory response | biological_proccess | IMP |
GO:0006916 | anti-apoptosis | biological_proccess | IMP |
GO:0006979 | response to oxidative stress | biological_proccess | TAS |
GO:0010310 | regulation of hydrogen peroxide metabolic process | biological_proccess | IMP |
GO:0010671 | negative regulation of oxygen and reactive oxygen species metabolic process | biological_proccess | IMP |
GO:0031665 | negative regulation of lipopolysaccharide-mediated signaling pathway | biological_proccess | IMP |
GO:0032088 | negative regulation of NF-kappaB transcription factor activity | biological_proccess | IMP |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IMP |
GO:0042098 | T cell proliferation | biological_proccess | IMP |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IMP |
GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
GO:0045581 | negative regulation of T cell differentiation | biological_proccess | IMP |
GO:0048538 | thymus development | biological_proccess | IMP |
GO:0048872 | homeostasis of number of cells | biological_proccess | IMP |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0006800 | oxygen and reactive oxygen species metabolic process | biological_proccess | TAS |
GO:0042743 | hydrogen peroxide metabolic process | biological_proccess | IMP |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0008379 | thioredoxin peroxidase activity | mollecular_function | TAS |
GO:0008430 | selenium binding | mollecular_function | TAS |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0004601 | peroxidase activity | mollecular_function | TAS |
GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
GO:0008379 | thioredoxin peroxidase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:109486
- Ensembl genome browser [?] : ENSMUSG00000005161
- Expression info from Arrayexpress [?] : ENSMUSG00000005161
- Protein expression from Protein Atlas: [?] ENSMUSG00000005161
- Community gene edition from Wikigenes: [?] 21672
Click on [?] for more information.