AC150744.2 (Mus musculus)
Description [+]
- Synonyms: AC150744.2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: GAPDH Fragment [Source:UniProtKB/TrEMBL;Acc:Q2VWQ4]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: AC150744.2-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Gp_dh_N | 2 | 150 |
PFAM A | Gp_dh_C | 155 | 312 |
Protein sequence [+]
AC150744.2 | Mus musculus | 10090 | length:333
MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKA
ENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGPHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLTPLAKVIHDNFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNRKFTGMAFRVPTPNMSV
VDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIA
LNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
ENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGPHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLTPLAKVIHDNFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNRKFTGMAFRVPTPNMSV
VDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIA
LNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
Structure links:
- Prosite motif and domain information: PS00071
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IMP |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity | mollecular_function | IMP |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0051287 | NAD or NADH binding | mollecular_function | IEA |
GO:0008943 | glyceraldehyde-3-phosphate dehydrogenase activity | mollecular_function | IEA |
GO:0005488 | binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMUSG00000078636
- Expression info from Arrayexpress [?] : ENSMUSG00000078636
- Protein expression from Protein Atlas: [?] ENSMUSG00000078636
- Community gene edition from Wikigenes: [?] 100041204
- entrezgene: 100041204
Click on [?] for more information.