PRDX6 (Mus musculus)
Description [+]
- Synonyms: PRDX6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: peroxiredoxin 5 Gene [Source:MGI (curated);Acc:Prdx6-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX6-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | AhpC-TSA | 7 | 146 |
PFAM A | 1-cysPrx_C | 156 | 218 |
Protein sequence [+]
Prdx6 | Mus musculus | 10090 | length:224
MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPV
EKDANNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVD
WKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
FAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPV
EKDANNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVD
WKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000302 | response to reactive oxygen species | biological_proccess | IMP |
GO:0032060 | bleb formation | biological_proccess | IMP |
GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
GO:0016042 | lipid catabolic process | biological_proccess | IEA |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0004601 | peroxidase activity | mollecular_function | IMP |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005764 | lysosome | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:894320
- Ensembl genome browser [?] : ENSMUSG00000026701
- Expression info from Arrayexpress [?] : ENSMUSG00000026701
- Protein expression from Protein Atlas: [?] ENSMUSG00000026701
- Community gene edition from Wikigenes: [?] 11758
Click on [?] for more information.