TNFSF15 (Mus musculus)
Description [+]
- Synonyms: TNFSF15
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: tumor necrosis factor (ligand) superfamily, member 15 Gene [Source:MGI (curated);Acc:Tnfsf15-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF15-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 118 | 252 |
Protein sequence [+]
Tnfsf15 | Mus musculus | 10090 | length:252
MAEELGLGFGEGVPVEVLPEGCRHRPEARAGLAARSKACLALTCCLLSFPILAGLSTLLM
AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHW
EHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITM
VITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGATFSLEEGDRLMVNVSDISLVDYT
KEDKTFFGAFLL
AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHW
EHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITM
VITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGATFSLEEGDRLMVNVSDISLVDYT
KEDKTFFGAFLL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0042107 | cytokine metabolic process | biological_proccess | ISO |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | ISO |
GO:0006919 | activation of caspase activity | biological_proccess | ISO |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
GO:0001937 | negative regulation of endothelial cell proliferation | biological_proccess | IEA |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IEA |
GO:0042107 | cytokine metabolic process | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | ISO |
GO:0005123 | death receptor binding | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | ISO |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:2180140
- Ensembl genome browser [?] : ENSMUSG00000050395
- Expression info from Arrayexpress [?] : ENSMUSG00000050395
- Protein expression from Protein Atlas: [?] ENSMUSG00000050395
- Community gene edition from Wikigenes: [?] 326623
Click on [?] for more information.