TRADD (Mus musculus)
Description [+]
- Synonyms: TRADD, TRADD, TNFRSF1A-ASSOCIATED VIA DEATH DOMAIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein)(TNFRSF1A-associated via death domain) [Source:UniProtKB/Swiss-Prot;Acc:Q3U0V2]
- Family: Death Domain-containing protein : DD adapter protein
- Process: apoptosis,
- Pathways: extrinsic pathway, TNF/NF-kappaB signaling,
- Criteria: manually curated
- Curator comment:
- WIKI: TRADD-M_musculus
References [+]
- The TNF receptor 1-associated protein TRADD signals cell death and NF-kappa B activation.
- Hsu H, Xiong J, Goeddel DV
- Many diverse activities of tumor necrosis factor (TNF) are signaled through TNF receptor 1 (TNFR1). We have identified a novel 34 kDa protein, designated TRADD, that specifically interacts with an intracellular domain of TNFR1 known to be essential for mediating programmed cell death. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa B. The C-terminal 118 amino acids of TRADD are sufficient to trigger both of these activities and likewise sufficient for interaction with the death domain of TNFR1. TRADD-mediated cell death can be suppressed by the crmA gene, which encodes a specific inhibitor of the interleukin-1 beta-converting enzyme. However, NF-kappa B activation by TRADD is not inhibited by crmA expression, demonstrating that the signaling pathways for TNF-induced cell death and NF-kappa B activation are distinct. Cell. 1995 May 19;81(4):495-504.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TRADD_N | 51 | 161 |
Protein sequence [+]
Tradd | Mus musculus | 10090 | length:310
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQ
ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGS
KFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPDGGLA
ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGS
KFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPDGGLA
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | RCA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | RCA |
GO:0004871 | signal transducer activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0070513 | death domain binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0019900 | kinase binding | mollecular_function | IEA |
GO:0060090 | molecular adaptor activity | mollecular_function | IEA |
GO:0019215 | intermediate filament binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005856 | cytoskeleton | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0043235 | receptor complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Curated Isoforms [+]
Transcript | Translation |
---|---|
OTTMUST00000067988 | OTTMUSP00000034502 |
OTTMUST00000067989 * | OTTMUSP00000034295 * |
OTTMUST00000068305 | OTTMUSP00000034501 |
OTTMUST00000068306 |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:109200
- Ensembl genome browser [?] : ENSMUSG00000031887
- Expression info from Arrayexpress [?] : ENSMUSG00000031887
- Protein expression from Protein Atlas: [?] ENSMUSG00000031887
- Community gene edition from Wikigenes: [?] 71609
- entrezgene: 71609
- refseq_dna: NM_001033161
- refseq_peptide: NP_001028333
Click on [?] for more information.