CD40LG (Mus musculus)
Description [+]
- Synonyms: CD40LG
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: CD40 ligand Gene [Source:MGI (curated);Acc:Cd40lg-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40LG-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 137 | 260 |
Protein sequence [+]
Cd40lg | Mus musculus | 10090 | length:260
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEVNLH
EDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQ
IAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNR
EPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNV
TEASQVIHRVGFSSFGLLKL
EDFVFIKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDITLNKEEKKENSFEMQRGDEDPQ
IAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNR
EPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNV
TEASQVIHRVGFSSFGLLKL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006916 | anti-apoptosis | biological_proccess | ISS |
GO:0006954 | inflammatory response | biological_proccess | ISS |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | NAS |
GO:0030168 | platelet activation | biological_proccess | ISS |
GO:0030183 | B cell differentiation | biological_proccess | IGI |
GO:0042100 | B cell proliferation | biological_proccess | ISS |
GO:0045190 | isotype switching | biological_proccess | IDA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IDA |
GO:0048305 | immunoglobulin secretion | biological_proccess | IGI |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0030168 | platelet activation | biological_proccess | IEA |
GO:0042100 | B cell proliferation | biological_proccess | IEA |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005174 | CD40 receptor binding | mollecular_function | ISS |
GO:0005174 | CD40 receptor binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:88337
- Ensembl genome browser [?] : ENSMUSG00000031132
- Expression info from Arrayexpress [?] : ENSMUSG00000031132
- Protein expression from Protein Atlas: [?] ENSMUSG00000031132
- Community gene edition from Wikigenes: [?] 21947
Click on [?] for more information.