FADD (Mus musculus)
Description [+]
- Synonyms: FADD, FADD, FAS (TNFRSF6)-ASSOCIATED VIA DEATH DOMAIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Protein FADD (FAS-associated death domain protein)(FAS-associating death domain-containing protein)(Mediator of receptor induced toxicity) [Source:UniProtKB/Swiss-Prot;Acc:Q61160]
- Family: Death Domain-containing protein : DD adapter protein Death effector domain-containing protein : DED adapter protein
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment:
- WIKI: FADD-M_musculus
References [+]
- Fas-mediated apoptosis and activation-induced T-cell proliferation are defective in mice lacking FADD/Mort1.
- Zhang J, Cado D, Chen A, Kabra NH, Winoto A
- Programmed cell death, or apoptosis, is important in homeostasis of the immune system: for example, non-functional or autoreactive lymphocytes are eliminated through apoptosis. One member of the tumour necrosis factor receptor (TNFR) family, Fas (also known as CD95 or Apo-1), can trigger cell death and is essential for lymphocyte homeostasis. FADD/Mort1 is a Fas-associated protein that is thought to mediate apoptosis by recruiting the protease caspase-8. A dominant-negative mutant of FADD inhibits apoptosis initiated by Fas and other TNFR family members. Other proteins, notably Daxx, also bind Fas and presumably mediate a FADD-independent apoptotic pathway. Here we investigate the role of FADD in vivo by generating FADD-deficient mice. As homozygous mice die in utero, we generated FADD-/- embryonic stem cells and FADD-/- chimaeras in a background devoid of the recombination activating gene RAG-1, which activates rearrangement of the immunoglobulin and T-cell receptor genes. We found that thymocyte subpopulations were apparently normal in newborn chimaeras. Fas-induced apoptosis was completely blocked, indicating that there are no redundant Fas apoptotic pathways. As these mice age, their thymocytes decrease to an undetectable level, although peripheral T cells are present in all older FADD-/- chimaeras. Unexpectedly, activation-induced proliferation is impaired in these FADD-/- T cells, despite production of the cytokine interleukin (IL)-2. These results and the similarities between FADD-/- mice and mice lacking the beta-subunit of the IL-2 receptor suggest that there is an unexpected connection between cell proliferation and apoptosis. Nature. 1998 Mar 19;392(6673):296-300.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | DED | 4 | 87 |
PFAM A | Death | 98 | 181 |
Protein sequence [+]
Fadd | Mus musculus | 10090 | length:205
MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGHT
GLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKRLARELK
VSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEA
QESVSKSENMSPVLRDSTVSSSETP
GLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKRLARELK
VSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEA
QESVSKSENMSPVLRDSTVSSSETP
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | RCA |
GO:0006915 | apoptosis | biological_proccess | RCA |
GO:0051291 | protein heterooligomerization | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0070265 | necrotic cell death | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0043234 | protein complex | cell_component | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0031264 | death-inducing signaling complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
miRNAs [+]
miRNA | Regulation | Description | Pubmed |
---|---|---|---|
mmu-miR-155 | overexpression by mature miRNA transfection | As shown in Fig. 3A, GFP fluorescence was markedly reduced in cells transfected with miR-155-FADD-target sequence, a result subsequently confirmed by luciferase assay (Fig. 3B) and Western blotting (Fig. 3C). | Ref. |
mmu-miR-155 | overexpression by mature miRNA transfection | As shown in Fig. 3A, GFP fluorescence was markedly reduced in cells transfected with miR-155-FADD-target sequence, a result subsequently confirmed by luciferase assay (Fig. 3B) and Western blotting (Fig. 3C). | Ref. |
mmu-miR-155 | overexpression by mature miRNA transfection | As shown in Fig. 3A, GFP fluorescence was markedly reduced in cells transfected with miR-155-FADD-target sequence, a result subsequently confirmed by luciferase assay (Fig. 3B) and Western blotting (Fig. 3C). | Ref. |
Curated Isoforms [+]
Transcript | Translation |
---|---|
OTTMUST00000083781 * | OTTMUSP00000045061 * |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:109324
- Ensembl genome browser [?] : ENSMUSG00000031077
- Expression info from Arrayexpress [?] : ENSMUSG00000031077
- Protein expression from Protein Atlas: [?] ENSMUSG00000031077
- Community gene edition from Wikigenes: [?] 14082
Click on [?] for more information.