AK2 (Mus musculus)
Description [+]
- Synonyms: AK2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: adenylate kinase 2 Gene [Source:MGI (curated);Acc:Ak2-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: AK2-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 20 | 206 |
PFAM A | ADK_lid | 142 | 177 |
Protein sequence [+]
Ak2 | Mus musculus | 10090 | length:239
MAPNVLASEPEIPKGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAFSKATCKDLVMFI
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAFSKATCKDLVMFI
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0005743 | mitochondrial inner membrane | cell_component | IDA |
GO:0005758 | mitochondrial intermembrane space | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:87978
- Ensembl genome browser [?] : ENSMUSG00000028792
- Expression info from Arrayexpress [?] : ENSMUSG00000028792
- Protein expression from Protein Atlas: [?] ENSMUSG00000028792
- Community gene edition from Wikigenes: [?] 100047005
- entrezgene: 11637
- entrezgene: 100047005
- refseq_dna: NM_016895
- refseq_dna: NM_001033966
- refseq_peptide: NP_058591
- refseq_peptide: NP_001029138
Click on [?] for more information.