PRDX1 (Mus musculus)
Description [+]
- Synonyms: PRDX1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: peroxiredoxin 1 Gene [Source:MGI (curated);Acc:Prdx1-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX1-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 7 | 163 |
PFAM A | AhpC-TSA | 8 | 142 |
PFAM A | 1-cysPrx_C | 152 | 195 |
Protein sequence [+]
Prdx1 | Mus musculus | 10090 | length:199
MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVNKSKEYFSKQK
DRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVNKSKEYFSKQK
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
GO:0000302 | response to reactive oxygen species | biological_proccess | IMP |
GO:0008283 | cell proliferation | biological_proccess | IMP |
GO:0019430 | removal of superoxide radicals | biological_proccess | IMP |
GO:0032872 | regulation of stress-activated MAPK cascade | biological_proccess | IMP |
GO:0034101 | erythrocyte homeostasis | biological_proccess | IMP |
GO:0042267 | natural killer cell mediated cytotoxicity | biological_proccess | IMP |
GO:0042345 | regulation of NF-kappaB import into nucleus | biological_proccess | IMP |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IDA |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | ISO |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
GO:0004601 | peroxidase activity | mollecular_function | ISO |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0042470 | melanosome | cell_component | IEA |
GO:0005634 | nucleus | cell_component | ISO |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:99523
- Ensembl genome browser [?] : ENSMUSG00000028691
- Expression info from Arrayexpress [?] : ENSMUSG00000028691
- Protein expression from Protein Atlas: [?] ENSMUSG00000028691
- Community gene edition from Wikigenes: [?] 637273
Click on [?] for more information.