FAS (Mus musculus)
Description [+]
- Synonyms: FAS, FAS, FAS (TNF RECEPTOR SUPERFAMILY MEMBER 6)
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Tumor necrosis factor receptor superfamily member 6 Precursor (FASLG receptor)(Apoptosis-mediating surface antigen FAS)(Apo-1 antigen)(CD95 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P25446]
- Family: death receptor
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment:
- WIKI: FAS-M_musculus
References [+]
- Lymphoproliferation disorder in mice explained by defects in Fas antigen that mediates apoptosis.
- Watanabe-Fukunaga R, Brannan CI, Copeland NG, Jenkins NA, Nagata S
- Fas antigen is a cell-surface protein that mediates apoptosis. It is expressed in various tissues including the thymus and has structural homology with a number of cell-surface receptors, including tumour necrosis factor receptor and nerve growth factor receptor. Mice carrying the lymphoproliferation (lpr) mutation have defects in the Fas antigen gene. The lpr mice develop lymphadenopathy and suffer from a systemic lupus erythematosus-like autoimmune disease, indicating an important role for Fas antigen in the negative selection of autoreactive T cells in the thymus. Nature. 1992 Mar 26;356(6367):314-7.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 44 | 78 |
PFAM A | TNFR_c6 | 81 | 123 |
PFAM A | TNFR_c6 | 125 | 161 |
PFAM A | Death | 223 | 306 |
Protein sequence [+]
Fas | Mus musculus | 10090 | length:327
MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQ
PGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQN
TKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLI
PLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKF
ARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLD
KFQDMVQKDLGKSTPDTGNENEGQCLE
PGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQN
TKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLI
PLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKF
ARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLD
KFQDMVQKDLGKSTPDTGNENEGQCLE
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0002377 | immunoglobulin production | biological_proccess | IMP |
GO:0003014 | renal system process | biological_proccess | IMP |
GO:0006924 | activation-induced cell death of T cells | biological_proccess | IMP |
GO:0006925 | inflammatory cell apoptosis | biological_proccess | IDA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IDA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IMP |
GO:0009636 | response to toxin | biological_proccess | IMP |
GO:0010467 | gene expression | biological_proccess | IMP |
GO:0019724 | B cell mediated immunity | biological_proccess | IMP |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IGI |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IDA |
GO:0045060 | negative thymic T cell selection | biological_proccess | IMP |
GO:0045619 | regulation of lymphocyte differentiation | biological_proccess | IMP |
GO:0045637 | regulation of myeloid cell differentiation | biological_proccess | IMP |
GO:0048536 | spleen development | biological_proccess | IMP |
GO:0050869 | negative regulation of B cell activation | biological_proccess | IMP |
GO:0051260 | protein homooligomerization | biological_proccess | IDA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IMP |
GO:0051789 | response to protein stimulus | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | IMP |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IDA |
GO:0043029 | T cell homeostasis | biological_proccess | IMP |
GO:0007568 | aging | biological_proccess | IEA |
GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEA |
GO:0001666 | response to hypoxia | biological_proccess | IEA |
GO:0010035 | response to inorganic substance | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0043627 | response to estrogen stimulus | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0042698 | ovulation cycle | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IDA |
GO:0009897 | external side of plasma membrane | cell_component | IDA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0009986 | cell surface | cell_component | IDA |
GO:0005901 | caveola | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:95484
- Ensembl genome browser [?] : ENSMUSG00000024778
- Expression info from Arrayexpress [?] : ENSMUSG00000024778
- Protein expression from Protein Atlas: [?] ENSMUSG00000024778
- Community gene edition from Wikigenes: [?] 14102
Click on [?] for more information.