TXNL4A (Mus musculus)
Description [+]
- Synonyms: TXNL4A
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: thioredoxin-like 4A Gene [Source:MGI Symbol;Acc:MGI:1351613]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TXNL4A-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Acetyltransf_1 | 46 | 129 |
Protein sequence [+]
Txnl4a | Mus musculus | 10090 | length:220
MNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKM
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALH
LYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMADELRRQLVLKKGRYVVLGSKENQGS
TLPGSEEASQQENLAGGDSGSDGKDSTDVQDSLQTLGSAS
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALH
LYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMADELRRQLVLKKGRYVVLGSKENQGS
TLPGSEEASQQENLAGGDSGSDGKDSTDVQDSLQTLGSAS
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0008152 | metabolic process | biological_proccess | IEA |
| GO:0008080 | N-acetyltransferase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMUSG00000024571
- Expression info from Arrayexpress [?] : ENSMUSG00000024571
- Protein expression from Protein Atlas: [?] ENSMUSG00000024571
- refseq_dna: NM_001042408
- refseq_dna: NM_178604
- refseq_peptide: NP_848719
- refseq_peptide: NP_001035867
Click on [?] for more information.
