TNF (Mus musculus)
Description [+]
- Synonyms: TNF, TNF, TUMOR NECROSIS FACTOR, DIF, TNF ALPHA, TNF-ALPHA, TNFA, TNFALPHA, TNFSF1A, TUMOR NECROSIS FACTOR-ALPHA
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Tumor necrosis factor Precursor (TNF-alpha)(Tumor necrosis factor ligand superfamily member 2)(TNF-a)(Cachectin) [Contains Tumor necrosis factor, membrane form;Tumor necrosis factor, soluble form] [Source:UniProtKB/Swiss-Prot;Acc:P06804]
- Family: death ligand
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment:
- WIKI: TNF-M_musculus
References [+]
- Identity of tumour necrosis factor and the macrophage-secreted factor cachectin.
- Beutler B, Greenwald D, Hulmes JD, Chang M, Pan YC, Mathison J, Ulevitch R, Cerami A
- In mammals, several well-defined metabolic changes occur during infection, many of which are attributable to products of the reticuloendothelial system. Among these changes, a hypertriglyceridaemic state is frequently evident, resulting from defective triglyceride clearance, caused by systemic suppression of the enzyme lipoprotein lipase (LPL). We have found previously that macrophages secrete the hormone cachectin, which specifically suppresses LPL activity in cultured adipocytes (3T3-L1 cells). When originally purified from RAW 264.7 (mouse macrophage) cells, cachectin was shown to have a pI of 4.7, a subunit size of relative molecular mass (Mr) 17,000 and to form non-covalent multimers. A receptor for cachectin was identified on non-tumorigenic cultured cells and on normal mouse liver membranes. A new high-yield purification technique has enabled us to determine further details of the structure of mouse cachectin. We now report that a high degree of homology exists between the N-terminal sequence of mouse cachectin and the N-terminal sequence recently determined for human tumour necrosis factor (TNF). Purified cachectin also possesses potent TNF activity in vitro. These findings suggest that the 'cachectin' and 'TNF' activities of murine macrophage conditioned medium are attributable to a single protein, which modulates the metabolic activities of normal as well as neoplastic cells through interaction with specific high-affinity receptors. Nature. 1985 Aug 8-14;316(6028):552-4.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 105 | 235 |
Protein sequence [+]
Tnf | Mus musculus | 10090 | length:235
MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR
DEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCP
KDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
DEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCP
KDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IDA |
GO:0001775 | cell activation | biological_proccess | IEA |
GO:0001932 | regulation of protein amino acid phosphorylation | biological_proccess | IDA |
GO:0002037 | negative regulation of L-glutamate transport | biological_proccess | IEA |
GO:0006006 | glucose metabolic process | biological_proccess | IDA |
GO:0006927 | transformed cell apoptosis | biological_proccess | TAS |
GO:0006954 | inflammatory response | biological_proccess | TAS |
GO:0006959 | humoral immune response | biological_proccess | IMP |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IMP |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | TAS |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IGI |
GO:0009612 | response to mechanical stimulus | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IMP |
GO:0019722 | calcium-mediated signaling | biological_proccess | IEA |
GO:0042742 | defense response to bacterium | biological_proccess | IDA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IDA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0045123 | cellular extravasation | biological_proccess | IDA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IDA |
GO:0045840 | positive regulation of mitosis | biological_proccess | IEA |
GO:0045941 | positive regulation of transcription | biological_proccess | IDA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IDA |
GO:0045994 | positive regulation of translational initiation by iron | biological_proccess | IDA |
GO:0046325 | negative regulation of glucose import | biological_proccess | IDA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IDA |
GO:0050806 | positive regulation of synaptic transmission | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IDA |
GO:0051222 | positive regulation of protein transport | biological_proccess | IEA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IMP |
GO:0008283 | cell proliferation | biological_proccess | TAS |
GO:0042127 | regulation of cell proliferation | biological_proccess | IDA |
GO:0030316 | osteoclast differentiation | biological_proccess | IGI |
GO:0006952 | defense response | biological_proccess | IMP |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IDA |
GO:0007254 | JNK cascade | biological_proccess | IGI |
GO:0050900 | leukocyte migration | biological_proccess | IDA |
GO:0006917 | induction of apoptosis | biological_proccess | IDA |
GO:0032755 | positive regulation of interleukin-6 production | biological_proccess | IDA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | ISO |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0002740 | negative regulation of cytokine secretion during immune response | biological_proccess | IEA |
GO:0000187 | activation of MAPK activity | biological_proccess | IEA |
GO:0043193 | positive regulation of gene-specific transcription | biological_proccess | IEA |
GO:0001934 | positive regulation of protein amino acid phosphorylation | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0016481 | negative regulation of transcription | biological_proccess | IEA |
GO:0050901 | leukocyte tethering or rolling | biological_proccess | IEA |
GO:0051044 | positive regulation of membrane protein ectodomain proteolysis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IEA |
GO:0006927 | transformed cell apoptosis | biological_proccess | IEA |
GO:0048661 | positive regulation of smooth muscle cell proliferation | biological_proccess | IEA |
GO:0032715 | negative regulation of interleukin-6 production | biological_proccess | IEA |
GO:0050995 | negative regulation of lipid catabolic process | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0030730 | sequestering of triglyceride | biological_proccess | IEA |
GO:0032722 | positive regulation of chemokine production | biological_proccess | IEA |
GO:0045071 | negative regulation of viral genome replication | biological_proccess | IEA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0042346 | positive regulation of NF-kappaB import into nucleus | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
GO:0002439 | chronic inflammatory response to antigenic stimulus | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0032800 | receptor biosynthetic process | biological_proccess | IEA |
GO:0050796 | regulation of insulin secretion | biological_proccess | IEA |
GO:0034116 | positive regulation of heterotypic cell-cell adhesion | biological_proccess | IEA |
GO:0045429 | positive regulation of nitric oxide biosynthetic process | biological_proccess | IEA |
GO:0060559 | biological_proccess | IEA | |
GO:0060557 | biological_proccess | IEA | |
GO:0060555 | biological_proccess | IEA | |
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IDA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0001891 | phagocytic cup | cell_component | IDA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IDA |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0009897 | external side of plasma membrane | cell_component | IDA |
GO:0030141 | secretory granule | cell_component | TAS |
GO:0045121 | membrane raft | cell_component | IDA |
GO:0055037 | recycling endosome | cell_component | IDA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:104798
- Ensembl genome browser [?] : ENSMUSG00000024401
- Expression info from Arrayexpress [?] : ENSMUSG00000024401
- Protein expression from Protein Atlas: [?] ENSMUSG00000024401
- Community gene edition from Wikigenes: [?] 21926
Click on [?] for more information.