MAPK9 (Mus musculus)
Description [+]
- Synonyms: MAPK9
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: mitogen-activated protein kinase 9 Gene [Source:MGI (curated);Acc:Mapk9-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK9-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 26 | 321 |
PFAM A | Pkinase_Tyr | 26 | 274 |
Protein sequence [+]
Mapk9 | Mus musculus | 10090 | length:423
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0031558 | induction of apoptosis in response to chemical stimulus | biological_proccess | IGI |
GO:0046686 | response to cadmium ion | biological_proccess | IGI |
GO:0007254 | JNK cascade | biological_proccess | ISS |
GO:0010628 | positive regulation of gene expression | biological_proccess | IEA |
GO:0010744 | positive regulation of foam cell differentiation | biological_proccess | IEA |
GO:0007254 | JNK cascade | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004705 | JUN kinase activity | mollecular_function | ISS |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004705 | JUN kinase activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IC |
GO:0044445 | cytosolic part | cell_component | ISS |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1346862
- Ensembl genome browser [?] : ENSMUSG00000020366
- Expression info from Arrayexpress [?] : ENSMUSG00000020366
- Protein expression from Protein Atlas: [?] ENSMUSG00000020366
- Community gene edition from Wikigenes: [?] 26420
Click on [?] for more information.