FASL (Mus musculus)
Description [+]
- Synonyms: FASL, FASL, FAS LIGAND (TNF SUPERFAMILY, MEMBER 6)
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Tumor necrosis factor ligand superfamily member 6 (Fas antigen ligand)(Fas ligand)(CD95L protein)(CD178 antigen) [Contains Tumor necrosis factor ligand superfamily member 6, membrane form;Tumor necrosis factor ligand superfamily member 6, soluble form] [Source:UniProtKB/Swiss-Prot;Acc:P41047]
- Family: death ligand
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment:
- WIKI: FASL-M_musculus
References [+]
- Generalized lymphoproliferative disease in mice, caused by a point mutation in the Fas ligand.
- Takahashi T, Tanaka M, Brannan CI, Jenkins NA, Copeland NG, Suda T, Nagata S
- Mice homozygous for lpr (lymphoproliferation) or gld (generalized lymphoproliferative disease) develop lymphadenopathy and suffer from autoimmune disease. The lpr mice have a mutation in a cell-surface protein, Fas, that mediates apoptosis. Fas ligand (FasL) is a tumor necrosis factor (TNF)-related type II membrane protein and binds to Fas. Here, mouse Fasl gene was isolated and localized to the gld region of mouse chromosome 1. Activated splenocytes from gld mice express Fasl mRNA. However, FasL in gld mice carries a point mutation in the C-terminal region, which is highly conserved among members of the TNF family. The recombinant gld FasL expressed in COS cells could not induce apoptosis in cells expressing Fas. These results indicate that lpr and gld are mutations in Fas and Fasl, respectively, and suggest important roles of the Fas system in development of T cells as well as cytotoxic T lymphocyte-mediated cytotoxicity. Cell. 1994 Mar 25;76(6):969-76.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 158 | 279 |
Protein sequence [+]
Fasl | Mus musculus | 10090 | length:279
MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQ
PLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSL
KVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLV
INETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHS
SYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
PLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSL
KVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLV
INETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHS
SYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IDA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IGI |
GO:0046666 | retinal cell programmed cell death | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | IGI |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0006925 | inflammatory cell apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0070265 | necrotic cell death | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IDA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016023 | cytoplasmic membrane-bounded vesicle | cell_component | IEA |
GO:0005901 | caveola | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:99255
- Ensembl genome browser [?] : ENSMUSG00000000817
- Expression info from Arrayexpress [?] : ENSMUSG00000000817
- Protein expression from Protein Atlas: [?] ENSMUSG00000000817
- Community gene edition from Wikigenes: [?] 14103
Click on [?] for more information.