Q5XTR8_MACMU (Macaca mulatta)
Description [+]
- Synonyms: Q5XTR8_MACMU
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Cercopithecidae; Macaca mulatta
- Short gene description: Nerve growth factor receptor (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q5XTR8]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q5XTR8_MACMU-M_mulatta
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 32 | 64 |
PFAM A | TNFR_c6 | 67 | 107 |
PFAM A | TNFR_c6 | 109 | 146 |
PFAM A | TNFR_c6 | 149 | 188 |
PFAM A | Death | 345 | 421 |
Protein sequence [+]
Q5XTR8_MACMU | Macaca mulatta | 9544 | length:427
MRAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHGGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTATSTQEPEAPPEQDLIASTVADVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQSHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGFAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTATSTQEPEAPPEQDLIASTVADVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQSHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGFAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0007411 | axon guidance | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0016048 | detection of temperature stimulus | biological_proccess | IEA |
GO:0021675 | nerve development | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0040037 | negative regulation of fibroblast growth factor receptor signaling pathway | biological_proccess | IEA |
GO:0042488 | positive regulation of odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0048146 | positive regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0051799 | negative regulation of hair follicle development | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005035 | death receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0048406 | nerve growth factor binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMMUG00000014603
- Expression info from Arrayexpress [?] : ENSMMUG00000014603
- Protein expression from Protein Atlas: [?] ENSMMUG00000014603
Click on [?] for more information.