TNFC_MACMU (Macaca mulatta)
Description [+]
- Synonyms: TNFC_MACMU
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Cercopithecidae; Macaca mulatta
- Short gene description: Lymphotoxin-beta (LT-beta) (Tumor necrosis factor C) (TNF-C) (Tumor necrosis factor ligand superfamily member 3). [Source:UniProtKB/Swiss-Prot;Acc:Q5TM22]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFC_MACMU-M_mulatta
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 102 | 243 |
Protein sequence [+]
TNFC_MACMU | Macaca mulatta | 9544 | length:244
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTDTAD
PGAQAQQGLGFQKLPEEEPEADLSPGLPAAHLIGAPLKGQGLGWEATKEQAFLTSGTQFS
DADGLALPQDGLYYLYCLVGYRGRAPPGGAEPRGRSVTLRSSLYRAGGAYGPGTPELLLE
GAETVTPVLDPAGRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGA
VMVG
PGAQAQQGLGFQKLPEEEPEADLSPGLPAAHLIGAPLKGQGLGWEATKEQAFLTSGTQFS
DADGLALPQDGLYYLYCLVGYRGRAPPGGAEPRGRSVTLRSSLYRAGGAYGPGTPELLLE
GAETVTPVLDPAGRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGA
VMVG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0045084 | positive regulation of interleukin-12 biosynthetic process | biological_proccess | IEA |
GO:0048535 | lymph node development | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMMUG00000008849
- Expression info from Arrayexpress [?] : ENSMMUG00000008849
- Protein expression from Protein Atlas: [?] ENSMMUG00000008849
Click on [?] for more information.