LTA (Homo sapiens)
Description [+]
- Synonyms: LTA
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Lymphotoxin-alpha Precursor (LT-alpha)(TNF-beta)(Tumor necrosis factor ligand superfamily member 1) [Source:UniProtKB/Swiss-Prot;Acc:P01374]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LTA-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNF | 77 | 205 |
Protein sequence [+]
LTA | Homo sapiens | 9606 | length:205
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIPHLVLSPSTVFFGAFAL
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIPHLVLSPSTVFFGAFAL
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSG00000204496
- Expression info from Arrayexpress [?] : ENSG00000204496
- Protein expression from Protein Atlas: [?] ENSG00000204496
- Community gene edition from Wikigenes: [?] 4049
Click on [?] for more information.
