LTB (Homo sapiens)
Description [+]
- Synonyms: LTB
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Lymphotoxin-beta (LT-beta)(Tumor necrosis factor C)(TNF-C)(Tumor necrosis factor ligand superfamily member 3) [Source:UniProtKB/Swiss-Prot;Acc:Q06643]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LTB-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 102 | 243 |
Protein sequence [+]
LTB | Homo sapiens | 9606 | length:244
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETAD
PGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFS
DAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLE
GAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGA
VMVG
PGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFS
DAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLE
GAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGA
VMVG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0001775 | cell activation | biological_proccess | IEA |
GO:0002037 | negative regulation of L-glutamate transport | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0009612 | response to mechanical stimulus | biological_proccess | IEA |
GO:0019722 | calcium-mediated signaling | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0045840 | positive regulation of mitosis | biological_proccess | IEA |
GO:0046325 | negative regulation of glucose import | biological_proccess | IEA |
GO:0050806 | positive regulation of synaptic transmission | biological_proccess | IEA |
GO:0051222 | positive regulation of protein transport | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | TAS |
GO:0007267 | cell-cell signaling | biological_proccess | TAS |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0048535 | lymph node development | biological_proccess | IEA |
GO:0045084 | positive regulation of interleukin-12 biosynthetic process | biological_proccess | ISS |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005575 | cellular_component | cell_component | ND |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSG00000204487
- Expression info from Arrayexpress [?] : ENSG00000204487
- Protein expression from Protein Atlas: [?] ENSG00000204487
- Community gene edition from Wikigenes: [?] 4050
- OMIM gene information: 600978
- OMIM disease information:
Click on [?] for more information.