CD40 (Homo sapiens)
Description [+]
- Synonyms: CD40
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor receptor superfamily member 5 Precursor (CD40L receptor)(B-cell surface antigen CD40)(Bp50)(CDw40)(CD40 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P25942]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 26 | 59 |
Protein sequence [+]
CD40 | Homo sapiens | 9606 | length:277
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Structure links:
- Smartdomain prediction information: SM00208
- Prosite motif and domain information: PS00652
- Prosite motif and domain information: PS01186
- Profile motif and domain profile information: PS50050
- Interpro domain information: P25942
- PFAM domain and domain family information: P25942
- Protein 3D structures from PDB: 1D00 1FLL 1LB6 1CDF
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006461 | protein complex assembly | biological_proccess | TAS |
GO:0006954 | inflammatory response | biological_proccess | TAS |
GO:0042100 | B cell proliferation | biological_proccess | NAS |
GO:0030168 | platelet activation | biological_proccess | NAS |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEP |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IEA |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IEA |
GO:0050776 | regulation of immune response | biological_proccess | IEA |
GO:0048304 | positive regulation of isotype switching to IgG isotypes | biological_proccess | IEA |
GO:0042113 | B cell activation | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0002768 | immune response-regulating cell surface receptor signaling pathway | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | TAS |
GO:0019899 | enzyme binding | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | TAS |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0043231 | intracellular membrane-bounded organelle | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :11919
- Gene related info from GeneCards [?] : CD40
- Ensembl genome browser [?] : ENSG00000101017
- Expression info from Arrayexpress [?] : ENSG00000101017
- Protein expression from Protein Atlas: [?] ENSG00000101017
- Community gene edition from Wikigenes: [?] 958
Click on [?] for more information.