CMPK1 (Homo sapiens)
Description [+]
- Synonyms: CMPK1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: UMP-CMP kinase (EC 2.7.4.14)(Cytidylate kinase)(Deoxycytidylate kinase)(Cytidine monophosphate kinase)(Uridine monophosphate kinase)(Uridine monophosphate/cytidine monophosphate kinase)(UMP/CMP kinase)(UMP/CMPK) [Source:UniProtKB/Swiss-Prot;Acc:P30085]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: CMPK1-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 40 | 203 |
Protein sequence [+]
CMPK1 | Homo sapiens | 9606 | length:228
MLSRCRSGLLHVLGLSFLLQTRRPILLCSPRLMKPLVVFVLGGPGAGKGTQCARIVEKYG
YTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNK
FLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESL
EKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG
YTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNK
FLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESL
EKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0009220 | pyrimidine ribonucleotide biosynthetic process | biological_proccess | TAS |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0004849 | uridine kinase activity | mollecular_function | TAS |
GO:0004127 | cytidylate kinase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0016773 | phosphotransferase activity, alcohol group as acceptor | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | TAS |
GO:0005737 | cytoplasm | cell_component | TAS |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :18170
- Gene related info from GeneCards [?] : CMPK1
- Ensembl genome browser [?] : ENSG00000162368
- Expression info from Arrayexpress [?] : ENSG00000162368
- Protein expression from Protein Atlas: [?] ENSG00000162368
- Community gene edition from Wikigenes: [?] 51727
- OMIM gene information: 191710
- OMIM disease information:
Click on [?] for more information.