CD40LG (Homo sapiens)
Description [+]
- Synonyms: CD40LG
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: CD40 ligand (CD40-L)(Tumor necrosis factor ligand superfamily member 5)(TNF-related activation protein)(TRAP)(T-cell antigen Gp39)(CD154 antigen) [Contains CD40 ligand, membrane form;CD40 ligand, soluble form] [Source:UniProtKB/Swiss-Prot;Acc:P29965]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40LG-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 138 | 261 |
Protein sequence [+]
CD40LG | Homo sapiens | 9606 | length:261
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006954 | inflammatory response | biological_proccess | IDA |
GO:0030168 | platelet activation | biological_proccess | IDA |
GO:0007159 | leukocyte adhesion | biological_proccess | NAS |
GO:0042100 | B cell proliferation | biological_proccess | IDA |
GO:0006916 | anti-apoptosis | biological_proccess | IDA |
GO:0045190 | isotype switching | biological_proccess | ISS |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IDA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0030183 | B cell differentiation | biological_proccess | IEA |
GO:0045190 | isotype switching | biological_proccess | IEA |
GO:0048305 | immunoglobulin secretion | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005174 | CD40 receptor binding | mollecular_function | IPI |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0005886 | plasma membrane | cell_component | EXP |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | TAS |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :11935
- Gene related info from GeneCards [?] : CD40LG
- Ensembl genome browser [?] : ENSG00000102245
- Expression info from Arrayexpress [?] : ENSG00000102245
- Protein expression from Protein Atlas: [?] ENSG00000102245
- Community gene edition from Wikigenes: [?] 959
Click on [?] for more information.