FASL (Homo sapiens)
Description [+]
- Synonyms: FASL, FASL, CD178, FAS LIGAND
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor ligand superfamily member 6 (Fas antigen ligand)(Fas ligand)(CD95L protein)(Apoptosis antigen ligand)(APTL)(CD178 antigen) [Contains Tumor necrosis factor ligand superfamily member 6, membrane form;Tumor necrosis factor ligand superfamily member 6, soluble form]
- Family: Death ligand
- Process: apoptosis,
- Pathways: extrinsic pathway,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Fasl
- WIKI: FASL-H_sapiens
References [+]
- Molecular cloning and expression of the Fas ligand, a novel member of the tumor necrosis factor family.
- Suda T, Takahashi T, Golstein P, Nagata S
- The Fas antigen (Fas) belongs to the tumor necrosis factor (TNF)/nerve growth factor receptor family, and it mediates apoptosis. Using a soluble form of mouse Fas, prepared by fusion with human immunoglobulin Fc, Fas ligand was detected on the cell surface of a cytotoxic T cell hybridoma, PC60-d10S. A cell population that highly expresses Fas ligand was sorted using a fluorescence-activated cell sorter, and its cDNA was isolated from the sorted cells by expression cloning. The amino acid sequence indicated that Fas ligand is a type II transmembrane protein that belongs to the TNF family. The recombinant Fas ligand expressed in COS cells induced apoptosis in Fas-expressing target cells. Northern hybridization revealed that Fas ligand is expressed in activated splenocytes and thymocytes, consistent with its involvement in T cell-mediated cytotoxicity and in several nonlymphoid tissues, such as testis. Cell. 1993 Dec 17;75(6):1169-78.
- References from Mouse ortholog(s):
- Generalized lymphoproliferative disease in mice, caused by a point mutation in the Fas ligand.
- Takahashi T, Tanaka M, Brannan CI, Jenkins NA, Copeland NG, Suda T, Nagata S
- Mice homozygous for lpr (lymphoproliferation) or gld (generalized lymphoproliferative disease) develop lymphadenopathy and suffer from autoimmune disease. The lpr mice have a mutation in a cell-surface protein, Fas, that mediates apoptosis. Fas ligand (FasL) is a tumor necrosis factor (TNF)-related type II membrane protein and binds to Fas. Here, mouse Fasl gene was isolated and localized to the gld region of mouse chromosome 1. Activated splenocytes from gld mice express Fasl mRNA. However, FasL in gld mice carries a point mutation in the C-terminal region, which is highly conserved among members of the TNF family. The recombinant gld FasL expressed in COS cells could not induce apoptosis in cells expressing Fas. These results indicate that lpr and gld are mutations in Fas and Fasl, respectively, and suggest important roles of the Fas system in development of T cells as well as cytotoxic T lymphocyte-mediated cytotoxicity. Cell. 1994 Mar 25;76(6):969-76.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNF | 160 | 281 |
Protein sequence [+]
FASL | Homo sapiens | 9606 | length:281
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Structure links:
- Smartdomain prediction information: SM00207
- Prosite motif and domain information: PS00251
- Profile motif and domain profile information: PS50099
- Profile motif and domain profile information: PS50049
- Interpro domain information: P48023
- PFAM domain and domain family information: P48023
- Protein 3D structures from PDB: 1BZI
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| NP_001026730.1 | orthology | Chicken |
| G_gallus_ENSGALP00000034816 | orthology | Chicken |
| FASLG | orthology | Chimpanzee |
| Q9TTJ2_BOVIN | orthology | Cow |
| NP_001092329.1 | orthology | Cow |
| NP_001092329.1 | orthology | Cow |
| FASLG | orthology | Dog |
| FASLG | orthology | Fugu |
| FASLG | orthology | Horse |
| TNFL6_MACMU | orthology | Macaca |
| Fasl | orthology | Mouse |
| FASLG | orthology | Orangutan |
| FASLG | orthology | Ornithorhynchus |
| Faslg | orthology | Rat |
| FASLG | orthology | Tetraodon |
| FASLG | orthology | Xenopus |
| FASLG | orthology | Zebra finch |
| faslg | orthology | Zebrafish |
| NP_989922.1 | paralogy | Chicken |
| NP_989710.1 | paralogy | Chicken |
| A3RF19_CHICK | paralogy | Chicken |
| NP_001019749.1 | paralogy | Chicken |
| TNFSF11 | paralogy | Chimpanzee |
| TNFSF14 | paralogy | Chimpanzee |
| TNFSF10 | paralogy | Chimpanzee |
| TNFB_PANTR | paralogy | Chimpanzee |
| TNFA_PANTR | paralogy | Chimpanzee |
| TNFSF15 | paralogy | Chimpanzee |
| TNFB_BOVIN | paralogy | Cow |
| IPI00690656.3 | paralogy | Cow |
| IPI00701832.3 | paralogy | Cow |
| TNFA_BOVIN | paralogy | Cow |
| IPI00694513.2 | paralogy | Cow |
| NP_001095325.1 | paralogy | Cow |
| TNFB_CANFA | paralogy | Dog |
| TNFA_CANFA | paralogy | Dog |
| TNFSF15 | paralogy | Dog |
| TNFSF11 | paralogy | Dog |
| TNFSF10 | paralogy | Dog |
| TNFSF14 | paralogy | Dog |
| T_rubripes_ENSTRUP00000014307 | paralogy | Fugu |
| NP_001033074.1 | paralogy | Fugu |
| TNFSF10 (2 of 2) | paralogy | Fugu |
| TNFSF10 (1 of 2) | paralogy | Fugu |
| G_aculeatus_ENSGACP00000000611 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000013603 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000017676 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000022786 | paralogy | Gasterosteus |
| LTA | paralogy | Gorilla |
| Q8HZD8_9PRIM | paralogy | Gorilla |
| TNFSF15 | paralogy | Gorilla |
| TNFSF11 | paralogy | Gorilla |
| TNFSF10 | paralogy | Gorilla |
| TNFSF14 | paralogy | Gorilla |
| LTA | paralogy | Horse |
| TNFA_HORSE | paralogy | Horse |
| TNFSF15 | paralogy | Horse |
| TNFSF11 | paralogy | Horse |
| TNFSF14 | paralogy | Horse |
| TNFSF10 | paralogy | Horse |
| LTA | paralogy | Human |
| TNFSF11 | paralogy | Human |
| TNFSF14 | paralogy | Human |
| TNFSF15 | paralogy | Human |
| TNF | paralogy | Human |
| TNFSF10 | paralogy | Human |
| H_sapiens_ENSP00000372790 | paralogy | Human |
| LTA | paralogy | Human |
| H_sapiens_ENSP00000372988 | paralogy | Human |
| LTA | paralogy | Human |
| A_carolinensis_ENSACAP00000001868 | paralogy | Lyzard |
| TNFSF15 | paralogy | Lyzard |
| A_carolinensis_ENSACAP00000006055 | paralogy | Lyzard |
| TNFSF14 | paralogy | Lyzard |
| TNFSF10 | paralogy | Lyzard |
| TNFSF14 | paralogy | Macaca |
| TNFB_MACMU | paralogy | Macaca |
| TNFA_MACMU | paralogy | Macaca |
| TNFSF15 | paralogy | Macaca |
| TNFSF11 | paralogy | Macaca |
| TNFSF10 | paralogy | Macaca |
| O_latipes_ENSORLP00000002171 | paralogy | Medaka |
| O_latipes_ENSORLP00000008487 | paralogy | Medaka |
| O_latipes_ENSORLP00000010677 | paralogy | Medaka |
| O_latipes_ENSORLP00000013121 | paralogy | Medaka |
| TNFSF10 (2 of 2) | paralogy | Medaka |
| TNFSF10 (1 of 2) | paralogy | Medaka |
| O_latipes_ENSORLP00000020071 | paralogy | Medaka |
| CD40LG | paralogy | Monodelphis |
| LTA | paralogy | Monodelphis |
| TNFSF15 | paralogy | Monodelphis |
| TNF | paralogy | Monodelphis |
| TNFSF14 | paralogy | Monodelphis |
| TNFSF10 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000036348 | paralogy | Monodelphis |
| Tnfsf14 | paralogy | Mouse |
| Tnf | paralogy | Mouse |
| Lta | paralogy | Mouse |
| TRAIL | paralogy | Mouse |
| Tnfsf15 | paralogy | Mouse |
| TNFSF11 | paralogy | Orangutan |
| TNFSF10 | paralogy | Orangutan |
| LTA | paralogy | Orangutan |
| Q8HZD7_PONPY | paralogy | Orangutan |
| TNFSF15 | paralogy | Orangutan |
| O_anatinus_ENSOANP00000007357 | paralogy | Ornithorhynchus |
| TNFSF14 | paralogy | Ornithorhynchus |
| TNFSF10 | paralogy | Ornithorhynchus |
| TNFSF15 | paralogy | Ornithorhynchus |
| CD40LG | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000022049 | paralogy | Ornithorhynchus |
| O_cuniculus_ENSOCUP00000012761 | paralogy | Rabbit |
| O_cuniculus_ENSOCUP00000004879 | paralogy | Rabbit |
| TNFB_RABIT | paralogy | Rabbit |
| TNFSF14 | paralogy | Rabbit |
| TNFSF15 | paralogy | Rabbit |
| Tnf | paralogy | Rat |
| Lta | paralogy | Rat |
| Tnfsf15 | paralogy | Rat |
| Tnfsf10 | paralogy | Rat |
| TNF | paralogy | Tetraodon |
| TNFSF10 (1 of 2) | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000017112 | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000000039 | paralogy | Tetraodon |
| LTB | paralogy | Xenopus |
| X_tropicalis_ENSXETP00000005341 | paralogy | Xenopus |
| TNFSF10 | paralogy | Xenopus |
| CD40LG | paralogy | Xenopus |
| X_tropicalis_ENSXETP00000054163 | paralogy | Xenopus |
| TNFSF15 | paralogy | Xenopus |
| CD40LG | paralogy | Zebra finch |
| TNFSF15 | paralogy | Zebra finch |
| TNFSF10 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000012735 | paralogy | Zebra finch |
| tnfb | paralogy | Zebrafish |
| tnfa | paralogy | Zebrafish |
| tnfsf10l2 | paralogy | Zebrafish |
| tnfsf10l4 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0070265 | necrotic cell death | biological_proccess | IDA |
| GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IDA |
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0007267 | cell-cell signaling | biological_proccess | TAS |
| GO:0007165 | signal transduction | biological_proccess | TAS |
| GO:0008633 | activation of pro-apoptotic gene products | biological_proccess | EXP |
| GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEP |
| GO:0007186 | G-protein coupled receptor protein signaling pathway | biological_proccess | IEA |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0007155 | cell adhesion | biological_proccess | IEA |
| GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
| GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
| GO:0006925 | inflammatory cell apoptosis | biological_proccess | IEA |
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
| GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
| GO:0046666 | retinal cell programmed cell death | biological_proccess | IEA |
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
| GO:0005125 | cytokine activity | mollecular_function | IEA |
| GO:0005199 | structural constituent of cell wall | mollecular_function | IEA |
| GO:0005198 | structural molecule activity | mollecular_function | IEA |
| GO:0005179 | hormone activity | mollecular_function | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0005887 | integral to plasma membrane | cell_component | TAS |
| GO:0005615 | extracellular space | cell_component | IEA |
| GO:0005886 | plasma membrane | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0015629 | actin cytoskeleton | cell_component | IEA |
| GO:0016023 | cytoplasmic membrane-bounded vesicle | cell_component | IEA |
| GO:0005901 | caveola | cell_component | IEA |
| GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
| GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
| Transcript | Translation |
|---|---|
| OTTHUMT00000084276 * | OTTHUMP00000032708 * |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :11936
- Gene related info from GeneCards [?] : FASL
- Ensembl genome browser [?] : ENSG00000117560
- Expression info from Arrayexpress [?] : ENSG00000117560
- Protein expression from Protein Atlas: [?] ENSG00000117560
- Community gene edition from Wikigenes: [?] 356
Click on [?] for more information.
