PRDX3 (Homo sapiens)
Description [+]
- Synonyms: PRDX3
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Thioredoxin-dependent peroxide reductase, mitochondrial Precursor (EC 1.11.1.15)(Peroxiredoxin-3)(PRX III)(Antioxidant protein 1)(AOP-1)(Protein MER5 homolog)(HBC189) [Source:UniProtKB/Swiss-Prot;Acc:P30048]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX3-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 64 | 219 |
PFAM A | AhpC-TSA | 65 | 198 |
PFAM A | 1-cysPrx_C | 208 | 251 |
Protein sequence [+]
PRDX3 | Homo sapiens | 9606 | length:256
MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSC
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
KPSPAASKEYFQKVNQ
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
KPSPAASKEYFQKVNQ
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0033673 | negative regulation of kinase activity | biological_proccess | IDA |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IDA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IDA |
GO:0006979 | response to oxidative stress | biological_proccess | IMP |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IMP |
GO:0030099 | myeloid cell differentiation | biological_proccess | ISS |
GO:0032496 | response to lipopolysaccharide | biological_proccess | ISS |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IMP |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IMP |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IDA |
GO:0007005 | mitochondrion organization | biological_proccess | IMP |
GO:0034614 | cellular response to reactive oxygen species | biological_proccess | IMP |
GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0030099 | myeloid cell differentiation | biological_proccess | IEA |
GO:0001893 | maternal placenta development | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
GO:0019901 | protein kinase binding | mollecular_function | IPI |
GO:0008785 | alkyl hydroperoxide reductase activity | mollecular_function | NAS |
GO:0043027 | caspase inhibitor activity | mollecular_function | IMP |
GO:0008022 | protein C-terminus binding | mollecular_function | IPI |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0008385 | IkappaB kinase complex | cell_component | IPI |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0005769 | early endosome | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :9354
- Gene related info from GeneCards [?] : PRDX3
- Ensembl genome browser [?] : ENSG00000165672
- Expression info from Arrayexpress [?] : ENSG00000165672
- Protein expression from Protein Atlas: [?] ENSG00000165672
- Community gene edition from Wikigenes: [?] 10935
- OMIM gene information: 604769
- OMIM disease information:
Click on [?] for more information.