TNFSF11 (Homo sapiens)
Description [+]
- Synonyms: TNFSF11
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor ligand superfamily member 11 (Receptor activator of nuclear factor kappa B ligand)(RANKL)(TNF-related activation-induced cytokine)(TRANCE)(Osteoprotegerin ligand)(OPGL)(Osteoclast differentiation factor)(ODF)(CD254 antigen) [Contains Tumor necrosis factor ligand superfamily member 11, membrane form;Tumor necrosis factor ligand superfamily member 11, soluble form] [Source:UniProtKB/Swiss-Prot;Acc:O14788]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF11-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 185 | 313 |
Protein sequence [+]
TNFSF11 | Homo sapiens | 9606 | length:317
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0051260 | protein homooligomerization | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0030154 | cell differentiation | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | NAS |
GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IDA |
GO:0045780 | positive regulation of bone resorption | biological_proccess | IDA |
GO:0045453 | bone resorption | biological_proccess | IEA |
GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0030316 | osteoclast differentiation | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0009314 | response to radiation | biological_proccess | IEA |
GO:0045780 | positive regulation of bone resorption | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005125 | cytokine activity | mollecular_function | NAS |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | NAS |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | NAS |
GO:0005887 | integral to plasma membrane | cell_component | NAS |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :11926
- Gene related info from GeneCards [?] : TNFSF11
- Ensembl genome browser [?] : ENSG00000120659
- Expression info from Arrayexpress [?] : ENSG00000120659
- Protein expression from Protein Atlas: [?] ENSG00000120659
- Community gene edition from Wikigenes: [?] 8600
Click on [?] for more information.