GAPDH (Homo sapiens)
Description [+]
- Synonyms: GAPDH, GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
- Family: Other
- Process: cell death (other),
- Pathways: undefined,
- Criteria: manually curated
- Curator comment: GAPDH contributes to recovery from caspase-independent cell death (CICD) after mitochondrial permeabilization [17540177]
- Mouse ortholog(s): AC166827.2-201 Gapdh AC121959.3 AC102196.7 AC159881.2 AC121279.7 CT030181.13 AC134918.5 AC163335.6 AC147142.2-201 AC117588.11 OTTMUSG00000017911 AC150660.4 AC142167.4 OTTMUSG00000005300 AC134337.3 AC125407.4 EG277333 AC148327.3-203 AC125070.4 AC158396.2-202 AC150744.2 AC130841.4 AC156283.6
- WIKI: GAPDH-H_sapiens
References [+]
- GAPDH and autophagy preserve survival after apoptotic cytochrome c release in the absence of caspase activation.
- Colell A, Ricci JE, Tait S, Milasta S, Maurer U, Bouchier-Hayes L, Fitzgerald P, Guio-Carrion A, Waterhouse NJ, Li CW, Mari B, Barbry P, Newmeyer DD, Beere HM, Green DR
- In cells undergoing apoptosis, mitochondrial outer-membrane permeabilization (MOMP) is followed by caspase activation promoted by released cytochrome c. Although caspases mediate the apoptotic phenotype, caspase inhibition is generally not sufficient for survival following MOMP; instead cells undergo a caspase-independent cell death (CICD). Thus, MOMP may represent a point of commitment to cell death. Here, we identify glyceraldehyde-3-phosphate dehydrogenase (GAPDH) as a critical regulator of CICD. GAPDH-expressing cells preserved their clonogenic potential following MOMP, provided that caspase activation was blocked. GAPDH-mediated protection of cells from CICD involved an elevation in glycolysis and a nuclear function that correlated with and was replaced by an increase in Atg12 expression. Consistent with this, protection from CICD reflected an increase in and a dependence upon autophagy, associated with a transient decrease in mitochondrial mass. Therefore, GAPDH mediates an elevation in glycolysis and enhanced autophagy that cooperate to protect cells from CICD. Cell. 2007 Jun 1;129(5):983-97.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Gp_dh_N | 4 | 152 |
PFAM A | Gp_dh_C | 157 | 314 |
Protein sequence [+]
GAPDH | Homo sapiens | 9606 | length:335
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0006096 | glycolysis | biological_proccess | NAS |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity | mollecular_function | IEA |
GO:0051287 | NAD or NADH binding | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005488 | binding | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity | mollecular_function | NAS |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008943 | glyceraldehyde-3-phosphate dehydrogenase activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | NAS |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :4155
- Gene related info from GeneCards [?] : GAPDH
- Ensembl genome browser [?] : ENSG00000111640
- Expression info from Arrayexpress [?] : ENSG00000111640
- Protein expression from Protein Atlas: [?] ENSG00000111640
- Community gene edition from Wikigenes: [?] 2597
- OMIM gene information: 138400
- OMIM disease information:
Click on [?] for more information.